Citrus Sinensis ID: 013840

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-----

MAESKKEKKSSEERVKLFVGQVPKHMTEAQLLAMFKEFALVDEVNIIKDKTTRASRGCCFVICPSRQEADKAVNACHNKKTLPGASSPLQVKYADGELERLEHKLFIGMLPKNVSEAEVSALFSIYGTIKDLQILRGSQQTSKGCAFLKYETKEQALAALEAINGKHKMEGSSVPLVVKWADTEKERQARRAQKAQSQANNLPNADSQHPSLFGALPMGYAPPYNGYGYQASGSYGLMQYRLPPMQNQPGFHGIIPPVNQGNAMRGASPDLSSNMGPRNYAMPPSGFVGSGYPAVPGLQYPMPYPGGMLGHRPLNNSPGSVSPAVANSNPSTSSSGGTGSGGQIEGPPGANLFIYHIPQEFGDQELGNAFQAFGRVLSAKVFVDKATGVSKCFGFVSYESPASAQNAIAMMNGCQLGGKKLKVQLKRDNKQNKPY

cccccccccccccccEEEEEcccccccHHHHHHHHHccccEEEEEEEEccccccccccEEEEcccHHHHHHHHHHHcccccccccccccccccccccHHHccccEEEccccccccHHHHHHHHcccccEEEEEEEcccccccccEEEEEcccHHHHHHHHHHHHcccccccccccEEEEEcccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccEEEEEEEEccccccccEEEEEEcccHHHHHHHHHHHHccccccEEEEEEEcccccccccc

***************KLFVGQVPKHMTEAQLLAMFKEFALVDEVNIIKDKTTRASRGCCFVICPSRQEADKAVNACHNKKTLPG*****QVKYADGELERLEHKLFIGMLPKNVSEAEVSALFSIYGTIKDLQILRGSQQTSKGCAFLKYETKEQALAALEAING********VPLVVKW*******************************LFGALPMGYAPPYNGYGYQASGSYGLMQYRLPPMQNQPGFHGIIPPVNQGNAMRGAS**************************VPGLQYPMPYPGGMLGHRPLNNSPGSVSPAVANSNPSTS***********EGPPGANLFIYHIPQEFGDQELGNAFQAFGRVLSAKVFVDKATGVSKCFGFVSYESPASAQNAIAMMNGCQLGGKKLKV************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
CUGBP Elav-like family member 5	RNA-binding protein that may be implicated in the regulation of pre-mRNA alternative splicing.	probable	A0JM51

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3NMR, chain A
Confidence level:very confident
Coverage over the Query: 13-182
View the alignment between query and template
View the model in PyMOL

Template: 2QFJ, chain A
Confidence level:very confident
Coverage over the Query: 102-196,345-433
View the alignment between query and template
View the model in PyMOL

Template: 2ADC, chain A
Confidence level:very confident
Coverage over the Query: 101-187,202-210,233-240,281-298,322,336-429
View the alignment between query and template
View the model in PyMOL

Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 290-302
View the alignment between query and template
View the model in PyMOL