Citrus Sinensis ID: 013864


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-----
MKKEDAPDKGRTLSVDPNVPRWVCQNCRHFLCIVGVDSYADKYLNDSSRSTMHGSSIHASNSVLGSTRMDNSFVVLPKQRPQSHGVPPRPRGSSAQSEASQSGKAMDESFVVIYKSESASDGGGPHIPPPEGGTNGPMQPNNSGFHSTITVLKRAFEIATSQTQVEQPLCLECMRVLSDKLDKEVDDVTRDIEAYEACLQRLEGEARDVLSEADFLKEKLKIEEEERKLEAAIEETEKQNAEVNAELKELELKSKRFKELEERYWQEFNNFQFQLIAHQEERDAISSKIEVSQAHLELLKRTNVLNDAFPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHTMCQYFRPKFPYRIKIIPMGSYPRIMDSNNNTYELFGPVNLFWSTRYDKAMTLFLSCLKDFAEFANSKDQENNIPPDKCFKLPYK
cccccccccccccccccccccccccccccccEEccccccccccccccccHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEECcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEcccccEEECccccCEEcccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccc
*****************NVPRWVCQNCRHFLCIVGVDSYADKYL*****************************************************************************************************HSTITVLKRAFEIATSQTQVEQPLCLECMRVLSDKLDKEVDDVTRDIEAYEACLQRLEGEARDVL**********************************************FKELEERYWQEFNNFQFQLIAHQEERDAISSKIEVSQAHLELLKRTNVLNDAFPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHTMCQYFRPKFPYRIKIIPMGSYPRIMDSNNNTYELFGPVNLFWSTRYDKAMTLFLSCLKDFAEFANSK*****IPPDKCFKLPYK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKEDAPDKGRTLSVDPNVPRWVCQNCRHFLCIVGVDSYADKYLNDSSRSTMHGSSIHASNSVLGSTRMDNSFVVLPKQRPQSHGVPPRPRGSSAQSEASQSGKAMDESFVVIYKSESASDGGGPHIPPPEGGTNGPMQPNNSGFHSTITVLKRAFEIATSQTQVEQPLCLECMRVLSDKLDKExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxYWQEFNNFQFQLIAHQEERDAISSKIEVSQAHLELLKRTNVLNDAFPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHTMCQYFRPKFPYRIKIIPMGSYPRIMDSNNNTYELFGPVNLFWSTRYDKAMTLFLSCLKDFAEFANSKDQENNIPPDKCFKLPYK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Beclin-1-like protein confidentQ9M367

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DDP, chain A
Confidence level:very confident
Coverage over the Query: 283-435
View the alignment between query and template
View the model in PyMOL
Template: 1C1G, chain A
Confidence level:very confident
Coverage over the Query: 181-200
View the alignment between query and template
View the model in PyMOL
Template: 2DFS, chain A
Confidence level:very confident
Coverage over the Query: 230-253
View the alignment between query and template
View the model in PyMOL
Template: 3Q8T, chain A
Confidence level:confident
Coverage over the Query: 230-302
View the alignment between query and template
View the model in PyMOL
Template: 2P1L, chain B
Confidence level:probable
Coverage over the Query: 142-161
View the alignment between query and template
View the model in PyMOL
Template: 1G8X, chain A
Confidence level:probable
Coverage over the Query: 151-283
View the alignment between query and template
View the model in PyMOL