BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 013866
(435 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3LPO|A Chain A, Crystal Structure Of The N-Terminal Domain Of
Sucrase-Isomal
pdb|3LPO|B Chain B, Crystal Structure Of The N-Terminal Domain Of
Sucrase-Isomal
pdb|3LPO|C Chain C, Crystal Structure Of The N-Terminal Domain Of
Sucrase-Isomal
pdb|3LPO|D Chain D, Crystal Structure Of The N-Terminal Domain Of
Sucrase-Isomal
pdb|3LPP|A Chain A, Crystal Complex Of N-Terminal Sucrase-Isomaltase With
Kotala
pdb|3LPP|B Chain B, Crystal Complex Of N-Terminal Sucrase-Isomaltase With
Kotala
pdb|3LPP|C Chain C, Crystal Complex Of N-Terminal Sucrase-Isomaltase With
Kotala
pdb|3LPP|D Chain D, Crystal Complex Of N-Terminal Sucrase-Isomaltase With
Kotala
Length = 898
Score = 28.9 bits (63), Expect = 5.9, Method: Compositional matrix adjust.
Identities = 13/31 (41%), Positives = 18/31 (58%)
Query: 330 DELLFSQKPLLAKDTKRFLSITLVLLVFSYT 360
D F Q LL K ++++L+I LL F YT
Sbjct: 638 DPAFFGQNSLLVKSSRQYLTIRYTLLPFLYT 668
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.328 0.140 0.414
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,483,681
Number of Sequences: 62578
Number of extensions: 373471
Number of successful extensions: 824
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 823
Number of HSP's gapped (non-prelim): 2
length of query: 435
length of database: 14,973,337
effective HSP length: 102
effective length of query: 333
effective length of database: 8,590,381
effective search space: 2860596873
effective search space used: 2860596873
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 53 (25.0 bits)