BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 013866
         (435 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3LPO|A Chain A, Crystal Structure Of The N-Terminal Domain Of
           Sucrase-Isomal
 pdb|3LPO|B Chain B, Crystal Structure Of The N-Terminal Domain Of
           Sucrase-Isomal
 pdb|3LPO|C Chain C, Crystal Structure Of The N-Terminal Domain Of
           Sucrase-Isomal
 pdb|3LPO|D Chain D, Crystal Structure Of The N-Terminal Domain Of
           Sucrase-Isomal
 pdb|3LPP|A Chain A, Crystal Complex Of N-Terminal Sucrase-Isomaltase With
           Kotala
 pdb|3LPP|B Chain B, Crystal Complex Of N-Terminal Sucrase-Isomaltase With
           Kotala
 pdb|3LPP|C Chain C, Crystal Complex Of N-Terminal Sucrase-Isomaltase With
           Kotala
 pdb|3LPP|D Chain D, Crystal Complex Of N-Terminal Sucrase-Isomaltase With
           Kotala
          Length = 898

 Score = 28.9 bits (63), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 18/31 (58%)

Query: 330 DELLFSQKPLLAKDTKRFLSITLVLLVFSYT 360
           D   F Q  LL K ++++L+I   LL F YT
Sbjct: 638 DPAFFGQNSLLVKSSRQYLTIRYTLLPFLYT 668


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.328    0.140    0.414 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,483,681
Number of Sequences: 62578
Number of extensions: 373471
Number of successful extensions: 824
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 823
Number of HSP's gapped (non-prelim): 2
length of query: 435
length of database: 14,973,337
effective HSP length: 102
effective length of query: 333
effective length of database: 8,590,381
effective search space: 2860596873
effective search space used: 2860596873
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 53 (25.0 bits)