BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 013874
         (434 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1J0A|A Chain A, Crystal Structure Analysis Of The Acc Deaminase Homologue
 pdb|1J0A|B Chain B, Crystal Structure Analysis Of The Acc Deaminase Homologue
 pdb|1J0A|C Chain C, Crystal Structure Analysis Of The Acc Deaminase Homologue
 pdb|1J0B|A Chain A, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
 pdb|1J0B|B Chain B, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
 pdb|1J0B|C Chain C, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
 pdb|1J0B|D Chain D, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
 pdb|1J0B|E Chain E, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
 pdb|1J0B|F Chain F, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
 pdb|1J0B|G Chain G, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
 pdb|1J0B|H Chain H, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
 pdb|1J0B|I Chain I, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
 pdb|1J0B|J Chain J, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
 pdb|1J0B|K Chain K, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
 pdb|1J0B|L Chain L, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
 pdb|1J0B|M Chain M, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
 pdb|1J0B|N Chain N, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
 pdb|1J0B|O Chain O, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
 pdb|1J0B|P Chain P, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
 pdb|1J0B|Q Chain Q, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
 pdb|1J0B|R Chain R, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
 pdb|1J0B|S Chain S, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
 pdb|1J0B|T Chain T, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
 pdb|1J0B|U Chain U, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
 pdb|1J0B|V Chain V, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
 pdb|1J0B|W Chain W, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
 pdb|1J0B|X Chain X, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
          Length = 325

 Score = 28.9 bits (63), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 28/47 (59%)

Query: 8   DSCLQGSEPLITVEALHQLHILIFFLAVFHVLYSAITMMLGRLKIRG 54
           D+  +G++ +ITV A+H  H  +  LA   +   AI ++ G+ +++G
Sbjct: 64  DALSKGADVVITVGAVHSNHAFVTGLAAKKLGLDAILVLRGKEELKG 110


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.326    0.138    0.435 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,812,466
Number of Sequences: 62578
Number of extensions: 440484
Number of successful extensions: 971
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 970
Number of HSP's gapped (non-prelim): 1
length of query: 434
length of database: 14,973,337
effective HSP length: 102
effective length of query: 332
effective length of database: 8,590,381
effective search space: 2852006492
effective search space used: 2852006492
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 53 (25.0 bits)