BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 013874
(434 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1J0A|A Chain A, Crystal Structure Analysis Of The Acc Deaminase Homologue
pdb|1J0A|B Chain B, Crystal Structure Analysis Of The Acc Deaminase Homologue
pdb|1J0A|C Chain C, Crystal Structure Analysis Of The Acc Deaminase Homologue
pdb|1J0B|A Chain A, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
pdb|1J0B|B Chain B, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
pdb|1J0B|C Chain C, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
pdb|1J0B|D Chain D, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
pdb|1J0B|E Chain E, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
pdb|1J0B|F Chain F, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
pdb|1J0B|G Chain G, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
pdb|1J0B|H Chain H, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
pdb|1J0B|I Chain I, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
pdb|1J0B|J Chain J, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
pdb|1J0B|K Chain K, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
pdb|1J0B|L Chain L, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
pdb|1J0B|M Chain M, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
pdb|1J0B|N Chain N, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
pdb|1J0B|O Chain O, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
pdb|1J0B|P Chain P, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
pdb|1J0B|Q Chain Q, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
pdb|1J0B|R Chain R, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
pdb|1J0B|S Chain S, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
pdb|1J0B|T Chain T, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
pdb|1J0B|U Chain U, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
pdb|1J0B|V Chain V, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
pdb|1J0B|W Chain W, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
pdb|1J0B|X Chain X, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
Length = 325
Score = 28.9 bits (63), Expect = 5.3, Method: Compositional matrix adjust.
Identities = 14/47 (29%), Positives = 28/47 (59%)
Query: 8 DSCLQGSEPLITVEALHQLHILIFFLAVFHVLYSAITMMLGRLKIRG 54
D+ +G++ +ITV A+H H + LA + AI ++ G+ +++G
Sbjct: 64 DALSKGADVVITVGAVHSNHAFVTGLAAKKLGLDAILVLRGKEELKG 110
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.326 0.138 0.435
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,812,466
Number of Sequences: 62578
Number of extensions: 440484
Number of successful extensions: 971
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 970
Number of HSP's gapped (non-prelim): 1
length of query: 434
length of database: 14,973,337
effective HSP length: 102
effective length of query: 332
effective length of database: 8,590,381
effective search space: 2852006492
effective search space used: 2852006492
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 53 (25.0 bits)