Citrus Sinensis ID: 013908

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430----

MVQRMAVSLRFALLLFAAFVSFQLISASDDATILYESFDESFEGRWIVSQKDEYKGVWKHSKSEGHEDYGLLVGEPAKKYAIVKELDEPLSLKDGTVVLQYEVRLQNGLECGGAYLKYLRPQEAGWVSKEFDNESPYMIMFGPDKCGATNKVHFILKHKNPKSGEYIEHHLKNPPSVPSDKLTHVYTAILKPDNELRILIDGEEKQKANFLAADDFQPPLIPEKTIPDPDDKKPEDWDERAKIPDPDAVKPEDWDEDAPMEIEDEDAVKPEGWLDDDPEEIDDPEATKPEDWDDEEDGEWEAPKIDNPKCEAAPGCGEWKRPMKRNPAYKGKWHAPHIDNPNYKGIWKPQQIPNPNYFELDKPDFEPIAAVGIEIWTMQDGILFDNILISKDEKVAESYRASAWKPKFDVEKEKLKAEEAAAGSDGLAGFQVMD

cHHHHHHHHHHHHHHHHHHHHHHHccccccCEEEEcccccccccccEEccccccccEEEEEccccccccEEEEcccccccEEEEccccccccccccEEEEEEEEEEccccccccEEEEccccccccccccccccccEEEEEccccccccccEEEEEECccccccccEEEcccccccccccccccEEEEEEcccccEEEEEccEEEEECcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEccccEEcEEEEcccHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccccccc

*****AVSLRFALLLFAAFVSFQLISASDDATILYESFDESFEGRWIVSQKDEYKGVWKHSKSEGHEDYGLLVGEPAKKYAIVKELDEPLSLKDGTVVLQYEVRLQNGLECGGAYLKYLRPQEAGWVSKEFDNESPYMIMFGPDKCGATNKVHFILKHKNPKSGEYIEHHLKNPPSVPSDKLTHVYTAILKPDNELRILIDGEEKQKANFLAADDFQPP****************DWDERAKIPDPDAVKPEDWDEDAPMEIEDEDAVKPEGWLDDDPEEIDDPEATKPEDWDDEEDGEWEAPKIDNPKCEAAPGCGEWKRPMKRNPAYKGKWHAPHIDNPNYKGIWKPQQIPNPNYFELDKPDFEPIAAVGIEIWTMQDGILFDNILISKDEKVAESYRASAWKP***********************FQVM*

xxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Calnexin homolog 1	Calcium-binding protein that interacts with newly synthesized glycoproteins in the endoplasmic reticulum. It may act in assisting protein assembly and/or in the retention within the ER of unassembled protein subunits. It seems to play a major role in the quality control apparatus of the ER by the retention of incorrectly folded proteins.	confident	P29402
Calnexin homolog	Interacts with newly synthesized glycoproteins in the endoplasmic reticulum. It may act in assisting protein assembly and/or in the retention within the ER of unassembled protein subunits. It seems to play a major role in the quality control apparatus of the ER by the retention of incorrectly folded proteins.	probable	Q6Q487
Calnexin	Calcium-binding protein that interacts with newly synthesized glycoproteins in the endoplasmic reticulum. It may act in assisting protein assembly and/or in the retention within the ER of unassembled protein subunits. It seems to play a major role in the quality control apparatus of the ER by the retention of incorrectly folded proteins.	probable	P24643

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1JHN, chain A
Confidence level:very confident
Coverage over the Query: 22-406
View the alignment between query and template
View the model in PyMOL