Citrus Sinensis ID: 013920


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430----
MGFSMQPYGIQSMLKEGHKHMSGLDEAVLKNIDACKQLSTITRTSLGPNGMNKMVINHLDKLFVTNDAATIVNELEVQHPAAKLLVLAGKAQQEEIGDGANLTISFAGEILQGAEELIRMGLHPSEIISGYTKAINKTIEVLEELVEEGSENMDVRNTEEVIYRMKAAVASKQFGQEEILCPLIADACIQVCPKNPANFNVDNVRVAKLLGGGLHNSTIVRGMVLKSDAVGSIKNMEKAKVAVFAGGVDTSATETKGTVLIHNAEQLENYAKTEEAKVEGLIKAVAESGAEVIVSGAAVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVAMLKLCQPNPDDLGYVDSVSVEEIGGARVTIVRNEGGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIELARRLKEFSFKETG
cccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEcccHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHcccccccccccccEEEEEcccccccccEEEEEEEEccccccccEEEcccEEEEEEccccccccccccEEEEccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHcccEEEEEccHHHHHHHHHHHccEEccccccccccccccccEEEEEEEccEEEEEEECccccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHcccEEccccHHHHHHHHHHHHHHccccc
************************DEAVLKNIDACKQLSTITRTSLGPNGMNKMVINHLDKLFVTNDAATIVNELEVQHPAAKLLVLAGKAQQEEIGDGANLTISFAGEILQGAEELIRMGLHPSEIISGYTKAINKTIEVLEELVEEGSENMDVRNTEEVIYRMKAAVASKQFGQEEILCPLIADACIQVCPKNPANFNVDNVRVAKLLGGGLHNSTIVRGMVLKSDAVGSIKNMEKAKVAVFAGGVDTSATETKGTVLIHNAEQLENYAKTEEAKVEGLIKAVAESGAEVIVSGAAVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVAMLKLCQPNPDDLGYVDSVSVEEIGGARVTIVRNEGGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIELARRLKEFSF****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGFSMQPYGIQSMLKEGHKHMSGLDEAVLKNIDACKQLSTITRTSLGPNGMNKMVINHLDKLFVTNDAATIVNELEVQHPAAKLLVLAGKAQQEEIGDGANLTISFAGEILQGAEELIRMGLHPSEIISGYTKAINKTIEVLEELVEEGSENMDVRNTEEVIYRMKAAVASKQFGQEEILCPLIADACIQVCPKNPANFNVDNVRVAKLLGGGLHNSTIVRGMVLKSDAVGSIKNMEKAKVAVFAGGVDTSATETKGTVLIHNxxxxxxxxxxxxxxxxxxxxxVAESGAEVIVSGAAVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVAMLKLCQPNPDDLGYVDSVSVEEIGGARVTIVRNEGGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIELARRLKEFSFKETG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
T-complex protein 1 subunit theta Molecular chaperone; assists the folding of proteins upon ATP hydrolysis. As part of the BBS/CCT complex may play a role in the assembly of BBSome, a complex involved in ciliogenesis regulating transports vesicles to the cilia. Known to play a role, in vitro, in the folding of actin and tubulin.probableP50990
T-complex protein 1 subunit theta Molecular chaperone; assists the folding of proteins upon ATP hydrolysis. Known to play a role, in vitro, in the folding of actin and tubulin.probableQ552J0
T-complex protein 1 subunit theta Molecular chaperone; assists the folding of proteins upon ATP hydrolysis. As part of the BBS/CCT complex may play a role in the assembly of BBSome, a complex involved in ciliogenesis regulating transports vesicles to the cilia. Known to play a role, in vitro, in the folding of actin and tubulin.probableQ5RAP1

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3P9D, chain H
Confidence level:very confident
Coverage over the Query: 5-434
View the alignment between query and template
View the model in PyMOL