Citrus Sinensis ID: 013967


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430---
MTCMIDLNGKRPLEIDGDDDCHHQRNKSLKLSNSRKTAGTSREQSDDDQGSDDNLQSEDNQQADDHQQSNAGHSSDLDSLIQPIGRDNSISCLIRCSRSDYGSIASLNQSFRSLIRSGELYRLRRLNGVIEHWVYFSCHLLEWEAFDPIRRRWMHLPRMTSNECFMCSDKESLAVGTELLVFGRELTAHHISHVIYRYSILTNSWSSGMRMNAPRCLFGSASLGEIAILAGGSDLEGNILSSAEMYNSETQTWKVLPSMKNPRKMCSGVFMDGKFYVIGGIGGSDSKVLTCGEEYDLETETWTEIPNMSPARGGAARGTEMPASAEAPPLVAVVNNELYAADYADMEVRKYDKERRLWFTIGRLPERANSMNGWGLAFRACGDRLIVIGGPKASGEGFIELNSWVPSEGPPQWNLLARKQSANFVYNCAVMGC
cEEEEEccccccccccccccccccccccCECcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccHHHHccHHHHHHcccccEEEEccccccEEEEEEEEEEccCEEEEccccccEEEcccccccccccccccEEEEEccEEEEEcccccccccccEEEEEEcccccCEcccccccccccEEEEEEccEEEEEcccccccccccEEEEEEcccccEEEcccccccccccEEEEEccEEEEEccccccccccccEEEEECcccccEEEcccccccccccccccccccccccccCEEEEccEEEEEEccccEEEEEEcccccEEEEccccccccccccccEEEEEEccEEEEEEccccccccEEEEEEECccccccccEEEcccccccEEEEEEEEcc
********************************************************************************IQPIGRDNSISCLIRCSRSDYGSIASLNQSFRSLIRSGELYRLRRLNGVIEHWVYFSCHLLEWEAFDPIRRRWMHLPRMTSNECFMCSDKESLAVGTELLVFGRELTAHHISHVIYRYSILTNSWSSGMRMNAPRCLFGSASLGEIAILAGGSDLEGNILSSAEMYNSETQTWKVLPSMKNPRKMCSGVFMDGKFYVIGGIGGSDSKVLTCGEEYDLETETWTEIPNMSPARGGAARGTEMPASAEAPPLVAVVNNELYAADYADMEVRKYDKERRLWFTIGRLPERANSMNGWGLAFRACGDRLIVIGGPKASGEGFIELNSWVPSEGPPQWNLLARKQSANFVYNCAVMGC
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTCMIDLNGKRPLEIDGDDDCHHQRNKSLKLSNSRKTAGTSREQSDDDQGSDDNLQSEDNQQADDHQQSNAGHSSDLDSLIQPIGRDNSISCLIRCSRSDYGSIASLNQSFRSLIRSGELYRLRRLNGVIEHWVYFSCHLLEWEAFDPIRRRWMHLPRMTSNECFMCSDKESLAVGTELLVFGRELTAHHISHVIYRYSILTNSWSSGMRMNAPRCLFGSASLGEIAILAGGSDLEGNILSSAEMYNSETQTWKVLPSMKNPRKMCSGVFMDGKFYVIGGIGGSDSKVLTCGEEYDLETETWTEIPNMSPARGGAARGTEMPASAEAPPLVAVVNNELYAADYADMEVRKYDKERRLWFTIGRLPERANSMNGWGLAFRACGDRLIVIGGPKASGEGFIELNSWVPSEGPPQWNLLARKQSANFVYNCAVMGC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
F-box/kelch-repeat protein SKIP11 Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.probableQ8L736

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ZGK, chain A
Confidence level:very confident
Coverage over the Query: 114-315,330-431
View the alignment between query and template
View the model in PyMOL
Template: 2OVR, chain B
Confidence level:confident
Coverage over the Query: 77-314,329-408
View the alignment between query and template
View the model in PyMOL