BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 014037
         (432 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2D5F|A Chain A, Crystal Structure Of Recombinant Soybean Proglycinin A3b4
           Subunit, Its Comparison With Mature Glycinin A3b4
           Subunit, Responsible For Hexamer Assembly
 pdb|2D5F|B Chain B, Crystal Structure Of Recombinant Soybean Proglycinin A3b4
           Subunit, Its Comparison With Mature Glycinin A3b4
           Subunit, Responsible For Hexamer Assembly
 pdb|2D5H|A Chain A, Crystal Structure Of Recombinant Soybean Proglycinin A3b4
           Subunit, Its Comparison With Mature Glycinin A3b4
           Subunit, Responsible For Hexamer Assembly
 pdb|2D5H|B Chain B, Crystal Structure Of Recombinant Soybean Proglycinin A3b4
           Subunit, Its Comparison With Mature Glycinin A3b4
           Subunit, Responsible For Hexamer Assembly
 pdb|2D5H|C Chain C, Crystal Structure Of Recombinant Soybean Proglycinin A3b4
           Subunit, Its Comparison With Mature Glycinin A3b4
           Subunit, Responsible For Hexamer Assembly
 pdb|2D5H|D Chain D, Crystal Structure Of Recombinant Soybean Proglycinin A3b4
           Subunit, Its Comparison With Mature Glycinin A3b4
           Subunit, Responsible For Hexamer Assembly
 pdb|2D5H|E Chain E, Crystal Structure Of Recombinant Soybean Proglycinin A3b4
           Subunit, Its Comparison With Mature Glycinin A3b4
           Subunit, Responsible For Hexamer Assembly
 pdb|2D5H|F Chain F, Crystal Structure Of Recombinant Soybean Proglycinin A3b4
           Subunit, Its Comparison With Mature Glycinin A3b4
           Subunit, Responsible For Hexamer Assembly
          Length = 493

 Score = 33.5 bits (75), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 5/63 (7%)

Query: 26  KVCCAKVLNSTRSLTSNARRLLDFSPLPE-----KKESSRGVSFCGEPLKFSGGSQQIRR 80
           ++ CA V  S R+L  N   L  +SP P+     + + + G +F G P  F    QQ  R
Sbjct: 39  ELQCAGVTVSKRTLNRNGLHLPSYSPYPQMIIVVQGKGAIGFAFPGCPETFEKPQQQSSR 98

Query: 81  RGT 83
           RG+
Sbjct: 99  RGS 101


>pdb|1OD5|A Chain A, Crystal Structure Of Glycinin A3b4 Subunit Homohexamer
 pdb|1OD5|B Chain B, Crystal Structure Of Glycinin A3b4 Subunit Homohexamer
          Length = 492

 Score = 33.5 bits (75), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 5/63 (7%)

Query: 26  KVCCAKVLNSTRSLTSNARRLLDFSPLPE-----KKESSRGVSFCGEPLKFSGGSQQIRR 80
           ++ CA V  S R+L  N   L  +SP P+     + + + G +F G P  F    QQ  R
Sbjct: 38  ELQCAGVTVSKRTLNRNGLHLPSYSPYPQMIIVVQGKGAIGFAFPGCPETFEKPQQQSSR 97

Query: 81  RGT 83
           RG+
Sbjct: 98  RGS 100


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.324    0.136    0.406 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,530,457
Number of Sequences: 62578
Number of extensions: 384928
Number of successful extensions: 722
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 722
Number of HSP's gapped (non-prelim): 2
length of query: 432
length of database: 14,973,337
effective HSP length: 102
effective length of query: 330
effective length of database: 8,590,381
effective search space: 2834825730
effective search space used: 2834825730
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 53 (25.0 bits)