BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 014037
(432 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2D5F|A Chain A, Crystal Structure Of Recombinant Soybean Proglycinin A3b4
Subunit, Its Comparison With Mature Glycinin A3b4
Subunit, Responsible For Hexamer Assembly
pdb|2D5F|B Chain B, Crystal Structure Of Recombinant Soybean Proglycinin A3b4
Subunit, Its Comparison With Mature Glycinin A3b4
Subunit, Responsible For Hexamer Assembly
pdb|2D5H|A Chain A, Crystal Structure Of Recombinant Soybean Proglycinin A3b4
Subunit, Its Comparison With Mature Glycinin A3b4
Subunit, Responsible For Hexamer Assembly
pdb|2D5H|B Chain B, Crystal Structure Of Recombinant Soybean Proglycinin A3b4
Subunit, Its Comparison With Mature Glycinin A3b4
Subunit, Responsible For Hexamer Assembly
pdb|2D5H|C Chain C, Crystal Structure Of Recombinant Soybean Proglycinin A3b4
Subunit, Its Comparison With Mature Glycinin A3b4
Subunit, Responsible For Hexamer Assembly
pdb|2D5H|D Chain D, Crystal Structure Of Recombinant Soybean Proglycinin A3b4
Subunit, Its Comparison With Mature Glycinin A3b4
Subunit, Responsible For Hexamer Assembly
pdb|2D5H|E Chain E, Crystal Structure Of Recombinant Soybean Proglycinin A3b4
Subunit, Its Comparison With Mature Glycinin A3b4
Subunit, Responsible For Hexamer Assembly
pdb|2D5H|F Chain F, Crystal Structure Of Recombinant Soybean Proglycinin A3b4
Subunit, Its Comparison With Mature Glycinin A3b4
Subunit, Responsible For Hexamer Assembly
Length = 493
Score = 33.5 bits (75), Expect = 0.24, Method: Compositional matrix adjust.
Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 5/63 (7%)
Query: 26 KVCCAKVLNSTRSLTSNARRLLDFSPLPE-----KKESSRGVSFCGEPLKFSGGSQQIRR 80
++ CA V S R+L N L +SP P+ + + + G +F G P F QQ R
Sbjct: 39 ELQCAGVTVSKRTLNRNGLHLPSYSPYPQMIIVVQGKGAIGFAFPGCPETFEKPQQQSSR 98
Query: 81 RGT 83
RG+
Sbjct: 99 RGS 101
>pdb|1OD5|A Chain A, Crystal Structure Of Glycinin A3b4 Subunit Homohexamer
pdb|1OD5|B Chain B, Crystal Structure Of Glycinin A3b4 Subunit Homohexamer
Length = 492
Score = 33.5 bits (75), Expect = 0.26, Method: Compositional matrix adjust.
Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 5/63 (7%)
Query: 26 KVCCAKVLNSTRSLTSNARRLLDFSPLPE-----KKESSRGVSFCGEPLKFSGGSQQIRR 80
++ CA V S R+L N L +SP P+ + + + G +F G P F QQ R
Sbjct: 38 ELQCAGVTVSKRTLNRNGLHLPSYSPYPQMIIVVQGKGAIGFAFPGCPETFEKPQQQSSR 97
Query: 81 RGT 83
RG+
Sbjct: 98 RGS 100
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.324 0.136 0.406
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,530,457
Number of Sequences: 62578
Number of extensions: 384928
Number of successful extensions: 722
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 722
Number of HSP's gapped (non-prelim): 2
length of query: 432
length of database: 14,973,337
effective HSP length: 102
effective length of query: 330
effective length of database: 8,590,381
effective search space: 2834825730
effective search space used: 2834825730
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 53 (25.0 bits)