Citrus Sinensis ID: 014041


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430--
MMSQDHGLSVPSTLKGFVQEPNSNPNPNPSSNQLKRKRNLPGTPDPDAEVIALSPKSLMATNRFLCEICNKGFQRDQNLQLHRRGHNLPWKLKQRTNKEVRKKVYICPEKSCVHHDPSRALGDLTGIKKHFSRKHGEKKWKCEKCSKKYAVQSDWKAHSKICGTREYRCDCGTLFSRKDSFITHRAFCDALAEESARFTTISSTNPQAAAAIPQFSSVFRQQQQSAPGSELAGGANLSMSSSSSLPRGIPKEEEENKAYNLSESMTSLYPSNQSGQQQQQQQQQQQQGLAHMSATALLQKAAQMGSTRSNANNSTGFGLMSTSFNSFNQTDKNELHKFFKQPNQQVADNDQNLNELIMNSFSCPTNMGAVAGSSNASLLMANAKNASNEAERRLTRDFLGVGVESSRPLSQQELAKFMNLSSQYGGNPHHRS
ccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccHHHHHHHHHccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccHHHHHHHccccccccccccccc
ccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcHHHHHHcccEEEHHHccccccccHcHHHcccccccccHcccccccccEEEEEcccccccccccHHHHccHHHHHHHHcccccccccEccccccHHEEHccHHHHHccccccEEEcccccEEEcccccHEcHHHHHccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccHHHHHHHccccccccccccccc
mmsqdhglsvpstlkgfvqepnsnpnpnpssnqlkrkrnlpgtpdpdaevialspkslMATNRFLCEICNkgfqrdqnlqlhrrghnlpwklkqrtnKEVRkkvyicpekscvhhdpsralgdltgikkhfsrkhgekkwkcekcskkyavQSDWKAhskicgtreyrcdcgtlfsrkdsfiTHRAFCDALAEESARFttisstnpqaaaaipqfSSVFRQQqqsapgselagganlsmssssslprgipkeeeenkaynlsesmtslypsnqsgqQQQQQQQQQQQGLAHMSATALLQKAAQMgstrsnannstgfglmstsfnsfnqtdkNELHkffkqpnqqvadnDQNLNELIMNsfscptnmgavagssNASLLMANAKNASNEAERRLTRDFLgvgvessrplSQQELAKFMNlssqyggnphhrs
mmsqdhglSVPSTLKgfvqepnsnpnpnpssnqlKRKRNLPGTPDPDAEVIALSPKSLMATNRFLCEICNKGFQRDQnlqlhrrghnlpwklkqrtnkeVRKKVYIcpekscvhhdpsralgdltGIKKhfsrkhgekkwkcekcskkyavqsdwkahskicgtreyRCDCGTLFSRKDSFITHRAFCDALAEESARFTTISSTNPQAAAAIPQFSSVFRQQQQSAPGSELAGGANLSMSSSSSLPRGIPKEEEENKAYNLSESMTSLYPSNQSGQQQQQQQQQQQQGLAHMSATALLQKAAQMGSTRSNANNSTGFGLMSTSFNSFNQTDKNELHKFFKQPNQQVADNDQNLNELIMNSFSCPTNMGAVAGSSNASLLMANAKNASNEAERRLTRDFLGVGVESSRPLSQQELAKFmnlssqyggnphhrs
MMSQDHGLSVPSTLKGFVQEpnsnpnpnpssnQLKRKRNLPGTPDPDAEVIALSPKSLMATNRFLCEICNKGFQRDQNLQLHRRGHNLPWKLKQRTNKEVRKKVYICPEKSCVHHDPSRALGDLTGIKKHFSRKHGekkwkcekcskkYAVQSDWKAHSKICGTREYRCDCGTLFSRKDSFITHRAFCDALAEESARFTTISSTNPQAAAAIPqfssvfrqqqqsAPGSELAGGANLsmsssssLPRGIPKEEEENKAYNLSESMTSLYPSNQSGqqqqqqqqqqqqGLAHMSATALLQKAAQMGSTRSNANNSTGFGLMSTSFNSFNQTDKNELHKFFKQPNQQVADNDQNLNELIMNSFSCPTNMGAVAGSSNASLLMANAKNASNEAERRLTRDFLGVGVESSRPLSQQELAKFMNLSSQYGGNPHHRS
*******************************************************KSLMATNRFLCEICNKGFQRDQNLQLHRRGHNLPWKLKQRTNKEVRKKVYICPEKSCVHHDPSRALGDLTGIKKHFSRKHGEKKWKCEKCSKKYAVQSDWKAHSKICGTREYRCDCGTLFSRKDSFITHRAFCDALAEESARFT*************************************************************************************************************************************************************I***************************************************************************
**SQ*HGLSVPST*********************KRKRNLPGTPDPDAEVIALSPKSLMATNRFLCEICNKGFQRDQNLQLHRRGHNLPWKLKQR****V***VYICPEKSCVHHDPSRALGDLTGIKKHFSRKHGEKKWKCEKCSKKYAVQSDWKAHSKICGTREYRCDCGTLFSRKDSFITHRAFCDALAEE***********************************************************************************************************************************************************************************************************FLGVGVESSRPLSQQ********************
*********VPSTLKGFVQEPNSNPNPNPSSNQLKRKRNLPGTPDPDAEVIALSPKSLMATNRFLCEICNKGFQRDQNLQLHRRGHNLPWKLKQRTNKEVRKKVYICPEKSCVHHDPSRALGDLTGIKK*************EKCSKKYAVQSDWKAHSKICGTREYRCDCGTLFSRKDSFITHRAFCDALAEESARFTTISSTNPQAAAAIPQFSSV*************************************NKAYNLSESMTSL***********************MSATALLQ**********NANNSTGFGLMSTSFNSFNQTDKNELHKFFKQPNQQVADNDQNLNELIMNSFSCPTNMGAVAGSSNASLLMANAKNASNEAERRLTRDFLGVGVESSRPLSQQELAKFMNLSS**********
****************************************PGTPDPDAEVIALSPKSLMATNRFLCEICNKGFQRDQNLQLHRRGHNLPWKLKQRTNKEVRKKVYICPEKSCVHHDPSRALGDLTGIKKHFSRKHGEKKWKCEKCSKKYAVQSDWKAHSKICGTREYRCDCGTLFSRKDSFITHRAFCDALAEESARFT*******************************************************************************************************QMGS************************DKNELHKFFKQPNQQV***********************************************LTRDFLGVGVESSRPLSQQELAKFMN*************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMSQDHGLSVPSTLKGFVQEPNSNPNPNPSSNQLKRKRNLPGTPDPDAEVIALSPKSLMATNRFLCEICNKGFQRDQNLQLHRRGHNLPWKLKQRTNKEVRKKVYICPEKSCVHHDPSRALGDLTGIKKHFSRKHGEKKWKCEKCSKKYAVQSDWKAHSKICGTREYRCDCGTLFSRKDSFITHRAFCDALAEESARFTTISSTNPQAAAAIPQFSSVFRQQQQSAPGSELAGGANLSMSSSSSLPRGIPKEEEENKAYNLSESMTSLYPSNQSGQQQQQQQQQQQQGLAHMSATALLQKAAQMGSTRSNANNSTGFGLMSTSFNSFNQTDKNELHKFFKQPNQQVADNDQNLNELIMNSFSCPTNMGAVAGSSNASLLMANAKNASNEAERRLTRDFLGVGVESSRPLSQQELAKFMNLSSQYGGNPHHRS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query432 2.2.26 [Sep-21-2011]
Q700D2503 Zinc finger protein JACKD yes no 0.898 0.771 0.478 6e-99
Q9ZWA6506 Zinc finger protein MAGPI no no 0.361 0.308 0.842 1e-93
Q9FFH3466 Zinc finger protein NUTCR no no 0.851 0.789 0.464 1e-92
Q9C8N5499 Protein SENSITIVE TO PROT no no 0.437 0.378 0.318 5e-22
Q943I6522 Zinc finger protein STOP1 no no 0.430 0.356 0.315 2e-21
Q2QX40465 Zinc finger protein STAR3 no no 0.319 0.296 0.333 3e-19
Q8VWG3303 Protein TRANSPARENT TESTA no no 0.361 0.514 0.323 2e-15
O43313 823 ATM interactor OS=Homo sa yes no 0.321 0.168 0.314 5e-13
Q6P9S1 818 ATM interactor OS=Mus mus yes no 0.268 0.141 0.315 7e-12
Q61116645 Zinc finger protein 235 O no no 0.266 0.178 0.294 9e-08
>sp|Q700D2|JKD_ARATH Zinc finger protein JACKDAW OS=Arabidopsis thaliana GN=JKD PE=1 SV=1 Back     alignment and function desciption
 Score =  361 bits (926), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 218/456 (47%), Positives = 262/456 (57%), Gaps = 68/456 (14%)

Query: 31  SNQLKRKRNLPGTPDPDAEVIALSPKSLMATNRFLCEICNKGFQRDQNLQLHRRGHNLPW 90
           S+  K+KRN PGTPDPDA+VIALSP +LMATNRF+CEICNKGFQRDQNLQLHRRGHNLPW
Sbjct: 49  SSSAKKKRNQPGTPDPDADVIALSPTTLMATNRFVCEICNKGFQRDQNLQLHRRGHNLPW 108

Query: 91  KLKQRTNKEV-RKKVYICPEKSCVHHDPSRALGDLTGIKKHFSRKHGEKKWKCEKCSKKY 149
           KLKQR+ +EV +KKVYICP K+CVHHD SRALGDLTGIKKH+SRKHGEKKWKCEKCSKKY
Sbjct: 109 KLKQRSKQEVIKKKVYICPIKTCVHHDASRALGDLTGIKKHYSRKHGEKKWKCEKCSKKY 168

Query: 150 AVQSDWKAHSKICGTREYRCDCGTLFSRKDSFITHRAFCDALAEESARFTT-------IS 202
           AVQSDWKAH+K CGTREY+CDCGTLFSRKDSFITHRAFCDAL EE AR ++       IS
Sbjct: 169 AVQSDWKAHAKTCGTREYKCDCGTLFSRKDSFITHRAFCDALTEEGARMSSLSNNNPVIS 228

Query: 203 STN--------------------------PQAAAAIPQFSSVFRQQQQSAPGSELA---- 232
           +TN                          P   AAI QF   F     +     L+    
Sbjct: 229 TTNLNFGNESNVMNNPNLPHGFVHRGVHHPDINAAISQFGLGFGHDLSAMHAQGLSEMVQ 288

Query: 233 ---------------------GGANLSMSSSSSLPRGIPKEEEENKAYNLSESMTSLYPS 271
                                G     +  +S+ P         ++  + S    +L  S
Sbjct: 289 MASTGNHHLFPSSSSSLPDFSGHHQFQIPMTSTNPSLTLSSSSTSQQTSASLQHQTLKDS 348

Query: 272 NQSGQQQQQQQQQQQQGLAHMSATALLQKAAQMGSTRSNANNSTGFGLMSTSFNSFNQTD 331
           + S       + +Q + L+ MSATALLQKAAQMGSTRSN++ +  F    T  +S     
Sbjct: 349 SFSPLFSSSSENKQNKPLSPMSATALLQKAAQMGSTRSNSSTAPSFFAGPTMTSSSATAS 408

Query: 332 KNELHKFFKQPNQQVADNDQNLNELIMNSFSCPTNMGAVAGSSNASLLMANAKNASNEAE 391
                       QQ+  N+ N N L  N    P  +  V+ SS  +    + ++  N A+
Sbjct: 409 PPPRSSSPMMIQQQL--NNFNTNVLRENHNRAPPPLSGVSTSSVDNNPFQSNRSGLNPAQ 466

Query: 392 RR-LTRDFLGVGVE------SSRPLSQQELAKFMNL 420
           +  LTRDFLGV  E        RP   QELA+F  L
Sbjct: 467 QMGLTRDFLGVSNEHHPHQTGRRPFLPQELARFAPL 502




Probable transcription factor that regulates tissue boundaries and asymmetric cell division by a rapid up-regulation of 'SCARECROW' (SCR), thus controlling the nuclear localization of 'SHORT-ROOT' (SHR) and restricting its action. Required for radial patterning and stem cell maintenance. Counteracted by 'MAGPIE' (MGP).
Arabidopsis thaliana (taxid: 3702)
>sp|Q9ZWA6|MGP_ARATH Zinc finger protein MAGPIE OS=Arabidopsis thaliana GN=MGP PE=1 SV=1 Back     alignment and function description
>sp|Q9FFH3|NUC_ARATH Zinc finger protein NUTCRACKER OS=Arabidopsis thaliana GN=NUC PE=2 SV=1 Back     alignment and function description
>sp|Q9C8N5|STOP1_ARATH Protein SENSITIVE TO PROTON RHIZOTOXICITY 1 OS=Arabidopsis thaliana GN=STOP1 PE=2 SV=1 Back     alignment and function description
>sp|Q943I6|STOP1_ORYSJ Zinc finger protein STOP1 homolog OS=Oryza sativa subsp. japonica GN=Os01g0871200 PE=2 SV=1 Back     alignment and function description
>sp|Q2QX40|ART1_ORYSJ Zinc finger protein STAR3 OS=Oryza sativa subsp. japonica GN=STAR3 PE=2 SV=1 Back     alignment and function description
>sp|Q8VWG3|TT1_ARATH Protein TRANSPARENT TESTA 1 OS=Arabidopsis thaliana GN=TT1 PE=2 SV=1 Back     alignment and function description
>sp|O43313|ATMIN_HUMAN ATM interactor OS=Homo sapiens GN=ATMIN PE=1 SV=2 Back     alignment and function description
>sp|Q6P9S1|ATMIN_MOUSE ATM interactor OS=Mus musculus GN=Atmin PE=2 SV=2 Back     alignment and function description
>sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query432
297746237477 unnamed protein product [Vitis vinifera] 0.935 0.846 0.590 1e-136
297741581469 unnamed protein product [Vitis vinifera] 0.905 0.833 0.543 1e-124
359481520490 PREDICTED: zinc finger protein NUTCRACKE 0.930 0.820 0.530 1e-124
255557032525 nucleic acid binding protein, putative [ 0.953 0.784 0.493 1e-120
359478335527 PREDICTED: uncharacterized protein LOC10 0.965 0.791 0.514 1e-120
255583691 543 nucleic acid binding protein, putative [ 0.965 0.767 0.503 1e-115
147783024474 hypothetical protein VITISV_009698 [Viti 0.821 0.748 0.528 1e-112
224138662407 predicted protein [Populus trichocarpa] 0.858 0.911 0.525 1e-111
302398705478 C2H2L domain class transcription factor 0.891 0.805 0.524 1e-110
357472269 714 Zinc finger protein-like protein [Medica 0.898 0.543 0.485 1e-104
>gi|297746237|emb|CBI16293.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  490 bits (1261), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 294/498 (59%), Positives = 350/498 (70%), Gaps = 94/498 (18%)

Query: 2   MSQDHGLSVPSTLKGFVQEPNSNPNPNPSSNQLKRKRNLPGTPDPDAEVIALSPKSLMAT 61
           M++D GL++PS+++GFVQEPNSNPNPNPS+N +K+KRNLPGTPDP+AEVIALSPKSLMAT
Sbjct: 1   MAED-GLTLPSSIRGFVQEPNSNPNPNPSANPVKKKRNLPGTPDPEAEVIALSPKSLMAT 59

Query: 62  NRFLCEICNKGFQRDQNLQLHRRGHNLPWKLKQRTNKEVRKKVYICPEKSCVHHDPSRAL 121
           NRF+CEICNKGFQRDQNLQLHRRGHNLPWKL+QRT+KEVRKKVYICPEKSCVHH+P+RAL
Sbjct: 60  NRFICEICNKGFQRDQNLQLHRRGHNLPWKLRQRTSKEVRKKVYICPEKSCVHHNPTRAL 119

Query: 122 GDLTGIKKHFSRKHGEKKWKCEKCSKKYAVQSDWKAHSKICGTREYRCDCGTLFSRKDSF 181
           GDLTGIKKH+SRKHGEKKWKCEKCSKKYAVQSDWKAHSKICGTREY+CDCGTLFSRKDSF
Sbjct: 120 GDLTGIKKHYSRKHGEKKWKCEKCSKKYAVQSDWKAHSKICGTREYKCDCGTLFSRKDSF 179

Query: 182 ITHRAFCDALAEESARFTTISSTNP-------------QAAAAIPQFSS----VFRQQQQ 224
           ITHRAFCDALAEESAR T++S+ NP               A  IPQFSS    ++     
Sbjct: 180 ITHRAFCDALAEESARLTSVSAPNPIFRNELMNGSISNPQAHIIPQFSSPRLPLWLDHAN 239

Query: 225 S---------------APGS----ELAGGANLSMS-------------------SSSSLP 246
           S               AP S    E+   A +SM                    +SS+LP
Sbjct: 240 SHLNNPIGVNTNGSFLAPTSAGLPEMVQTAPMSMYGSPASSQNQWLQRCSEASFTSSTLP 299

Query: 247 RGIPKEEEENKAYNLSESMTSLYPSNQSGQQQQQQQQQQQQGLAHMSATALLQKAAQMGS 306
           R + KEEEENK  NLSES+TSL+ SNQ+          QQ+  AHMSATALLQKAAQMGS
Sbjct: 300 R-VLKEEEENKG-NLSESITSLFSSNQN----------QQESSAHMSATALLQKAAQMGS 347

Query: 307 TRSNAN--NSTGFGLM------STSFNSF-NQTDKNELHKFF-KQPNQQVADNDQNLNEL 356
           T+SN+   ++TGFG +      +T F+S+ +    N++HKF  +Q NQ       ++N+L
Sbjct: 348 TKSNSAFFSTTGFGSINSSLSNTTPFSSYPHGRSNNQVHKFLIRQSNQ-----SDSMNQL 402

Query: 357 IMNSFSCPTNM--GAVAGSSNASLLMANAKNASNEAERRLTRDFLGVGVESSRPLSQQEL 414
           I NS S  + M  G + G  N++ L      +SNE ER LTRDFLGVG ++SRP  QQEL
Sbjct: 403 I-NSTSPSSTMGDGLLMGDMNSTPLF---HASSNEVERGLTRDFLGVGSDASRPFLQQEL 458

Query: 415 AKFMNLS-----SQYGGN 427
           AKF ++      SQY GN
Sbjct: 459 AKFASMGSAMGMSQYSGN 476




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297741581|emb|CBI32713.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359481520|ref|XP_002275477.2| PREDICTED: zinc finger protein NUTCRACKER-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255557032|ref|XP_002519549.1| nucleic acid binding protein, putative [Ricinus communis] gi|223541412|gb|EEF42963.1| nucleic acid binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359478335|ref|XP_002282251.2| PREDICTED: uncharacterized protein LOC100248459 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255583691|ref|XP_002532599.1| nucleic acid binding protein, putative [Ricinus communis] gi|223527655|gb|EEF29765.1| nucleic acid binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147783024|emb|CAN61309.1| hypothetical protein VITISV_009698 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224138662|ref|XP_002322870.1| predicted protein [Populus trichocarpa] gi|222867500|gb|EEF04631.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|302398705|gb|ADL36647.1| C2H2L domain class transcription factor [Malus x domestica] Back     alignment and taxonomy information
>gi|357472269|ref|XP_003606419.1| Zinc finger protein-like protein [Medicago truncatula] gi|355507474|gb|AES88616.1| Zinc finger protein-like protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query432
TAIR|locus:2173624500 IDD1 "AT5G66730" [Arabidopsis 0.388 0.336 0.815 6.7e-90
TAIR|locus:2078262446 AT3G45260 "AT3G45260" [Arabido 0.465 0.450 0.726 9e-90
TAIR|locus:2143543503 JKD "AT5G03150" [Arabidopsis t 0.398 0.341 0.780 1.7e-88
TAIR|locus:2051698 602 IDD5 "AT2G02070" [Arabidopsis 0.398 0.285 0.761 1.2e-87
TAIR|locus:2024193506 MGP "AT1G03840" [Arabidopsis t 0.412 0.351 0.786 5.7e-86
TAIR|locus:2101739452 IDD2 "AT3G50700" [Arabidopsis 0.377 0.360 0.815 4.1e-85
TAIR|locus:2167608466 NUC "AT5G44160" [Arabidopsis t 0.416 0.386 0.766 3.5e-84
TAIR|locus:2051688516 IDD4 "indeterminate(ID)-domain 0.409 0.343 0.717 1.2e-83
TAIR|locus:2132397402 IDD12 "AT4G02670" [Arabidopsis 0.395 0.425 0.779 1.5e-81
TAIR|locus:2204503467 AT1G14580 "AT1G14580" [Arabido 0.393 0.364 0.764 4.1e-77
TAIR|locus:2173624 IDD1 "AT5G66730" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 754 (270.5 bits), Expect = 6.7e-90, Sum P(4) = 6.7e-90
 Identities = 137/168 (81%), Positives = 147/168 (87%)

Query:    35 KRKRNLPGTPDPDAEVIALSPKSLMATNRFLCEICNKGFQRDQNLQLHRRGHNLPWKLKQ 94
             K+KRNLPG PDPDAEVIALSPK+LMATNRF+CEICNKGFQRDQNLQLHRRGHNLPWKL+Q
Sbjct:    32 KKKRNLPGMPDPDAEVIALSPKTLMATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLRQ 91

Query:    95 RTNKEVRKKVYICPEKSCVHHDPSRALGDLTGIKKHFSRKHGXXXXXXXXXXXXYAVQSD 154
             R+ KEVRKKVY+CP   CVHHDPSRALGDLTGIKKHF RKHG            YAVQSD
Sbjct:    92 RSTKEVRKKVYVCPVSGCVHHDPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKKYAVQSD 151

Query:   155 WKAHSKICGTREYRCDCGTLFSRKDSFITHRAFCDALAEESARFTTIS 202
             WKAHSKICGT+EY+CDCGTLFSR+DSFITHRAFCDALAEESA+  T S
Sbjct:   152 WKAHSKICGTKEYKCDCGTLFSRRDSFITHRAFCDALAEESAKNHTQS 199


GO:0003676 "nucleic acid binding" evidence=ISS
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
GO:0005515 "protein binding" evidence=IPI
GO:0009937 "regulation of gibberellic acid mediated signaling pathway" evidence=IMP
GO:0010029 "regulation of seed germination" evidence=IMP
GO:0010431 "seed maturation" evidence=IMP
TAIR|locus:2078262 AT3G45260 "AT3G45260" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2143543 JKD "AT5G03150" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2051698 IDD5 "AT2G02070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024193 MGP "AT1G03840" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101739 IDD2 "AT3G50700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2167608 NUC "AT5G44160" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2051688 IDD4 "indeterminate(ID)-domain 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132397 IDD12 "AT4G02670" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2204503 AT1G14580 "AT1G14580" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00024511001
SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (526 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 432
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 99.95
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 99.91
KOG1074958 consensus Transcriptional repressor SALM [Transcri 99.76
KOG3576267 consensus Ovo and related transcription factors [T 99.76
KOG3608467 consensus Zn finger proteins [General function pre 99.7
KOG1074958 consensus Transcriptional repressor SALM [Transcri 99.69
KOG3576267 consensus Ovo and related transcription factors [T 99.64
KOG3608467 consensus Zn finger proteins [General function pre 99.56
KOG3623 1007 consensus Homeobox transcription factor SIP1 [Tran 99.48
KOG36231007 consensus Homeobox transcription factor SIP1 [Tran 99.48
PLN03086567 PRLI-interacting factor K; Provisional 99.25
PHA00733128 hypothetical protein 99.1
PLN03086567 PRLI-interacting factor K; Provisional 99.1
PHA00733128 hypothetical protein 98.95
KOG3993500 consensus Transcription factor (contains Zn finger 98.94
PHA0276855 hypothetical protein; Provisional 98.63
PHA0276855 hypothetical protein; Provisional 98.52
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.46
KOG3993500 consensus Transcription factor (contains Zn finger 98.32
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.17
PHA0061644 hypothetical protein 98.09
PHA0073279 hypothetical protein 97.96
PHA0061644 hypothetical protein 97.85
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.85
PHA0073279 hypothetical protein 97.84
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.83
COG5189423 SFP1 Putative transcriptional repressor regulating 97.82
COG5189423 SFP1 Putative transcriptional repressor regulating 97.71
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.5
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.35
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.34
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.26
COG5048467 FOG: Zn-finger [General function prediction only] 97.23
KOG2231 669 consensus Predicted E3 ubiquitin ligase [Posttrans 97.08
KOG2231 669 consensus Predicted E3 ubiquitin ligase [Posttrans 96.88
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 96.65
smart0035526 ZnF_C2H2 zinc finger. 96.64
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 96.64
KOG1146 1406 consensus Homeobox protein [General function predi 96.51
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 96.42
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 96.27
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.24
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.1
PRK04860160 hypothetical protein; Provisional 95.82
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 95.48
COG5048467 FOG: Zn-finger [General function prediction only] 95.44
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.2
PRK04860160 hypothetical protein; Provisional 94.86
COG5236493 Uncharacterized conserved protein, contains RING Z 94.38
KOG1146 1406 consensus Homeobox protein [General function predi 93.96
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 93.93
KOG2785390 consensus C2H2-type Zn-finger protein [General fun 93.69
smart0035526 ZnF_C2H2 zinc finger. 93.6
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 93.48
KOG4173253 consensus Alpha-SNAP protein [Intracellular traffi 93.46
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 93.45
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 93.42
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 93.11
COG5236493 Uncharacterized conserved protein, contains RING Z 93.1
KOG1280381 consensus Uncharacterized conserved protein contai 92.95
KOG3982 475 consensus Runt and related transcription factors [ 92.8
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 92.38
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 92.36
KOG2482423 consensus Predicted C2H2-type Zn-finger protein [T 92.32
KOG4377480 consensus Zn-finger protein [General function pred 89.72
PRK00464154 nrdR transcriptional regulator NrdR; Validated 89.69
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 89.53
KOG2071579 consensus mRNA cleavage and polyadenylation factor 86.65
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 86.04
KOG2893341 consensus Zn finger protein [General function pred 85.7
KOG1280381 consensus Uncharacterized conserved protein contai 85.49
KOG2893341 consensus Zn finger protein [General function pred 85.35
KOG2482423 consensus Predicted C2H2-type Zn-finger protein [T 85.2
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 85.09
KOG4173253 consensus Alpha-SNAP protein [Intracellular traffi 84.93
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 84.23
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 83.31
KOG2186276 consensus Cell growth-regulating nucleolar protein 82.01
PF09986214 DUF2225: Uncharacterized protein conserved in bact 81.79
KOG3982 475 consensus Runt and related transcription factors [ 81.43
COG5151421 SSL1 RNA polymerase II transcription initiation/nu 80.94
COG404965 Uncharacterized protein containing archaeal-type C 80.88
KOG18831517 consensus Cofactor required for Sp1 transcriptiona 80.6
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
Probab=99.95  E-value=1.5e-28  Score=228.32  Aligned_cols=135  Identities=21%  Similarity=0.395  Sum_probs=127.4

Q ss_pred             CCCCcCCCCCCCCCCChhhhhcCccccCC---CCceecccccccccChHHHHHHHHhcCCCcccccccccccCCcceeCC
Q 014041           32 NQLKRKRNLPGTPDPDAEVIALSPKSLMA---TNRFLCEICNKGFQRDQNLQLHRRGHNLPWKLKQRTNKEVRKKVYICP  108 (432)
Q Consensus        32 ~~~k~~c~~cg~~~~~~~~l~~h~~~h~~---~k~f~C~~Cgk~F~~~~~L~~H~r~H~~~~~~~~~~~~~~~~k~y~C~  108 (432)
                      ...+|+|+.|||.|.+...|.+|+.+|-.   .+.|.|++|||.|..-..|+.|+|+|+               -+++|.
T Consensus       127 ~~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~---------------l~c~C~  191 (279)
T KOG2462|consen  127 KHPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT---------------LPCECG  191 (279)
T ss_pred             cCCceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC---------------CCcccc
Confidence            46699999999999999999999999853   677999999999999999999999997               469999


Q ss_pred             CCCCCCCCCCCccCCHHHHHHHHhhhcCCCcccccccccccCChHHhhhhhcc-cCCcceeec-CCCccCCchHHHHHHH
Q 014041          109 EKSCVHHDPSRALGDLTGIKKHFSRKHGEKKWKCEKCSKKYAVQSDWKAHSKI-CGTREYRCD-CGTLFSRKDSFITHRA  186 (432)
Q Consensus       109 ~C~c~~~~c~k~f~~~~~L~~H~~~H~gekp~~C~~C~k~F~~~~~L~~H~~~-~~~k~~~C~-C~~~F~~~~~L~~H~~  186 (432)
                      +|       ||.|.+.+-|..|+|+|+|||||.|..|+|.|..+++|+.||++ .+.|+|.|. |+|+|..++.|.+|..
T Consensus       192 iC-------GKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~E  264 (279)
T KOG2462|consen  192 IC-------GKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSE  264 (279)
T ss_pred             cc-------cccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhh
Confidence            99       99999999999999999999999999999999999999999999 789999999 9999999999999987


Q ss_pred             Hh
Q 014041          187 FC  188 (432)
Q Consensus       187 ~h  188 (432)
                      ..
T Consensus       265 S~  266 (279)
T KOG2462|consen  265 SA  266 (279)
T ss_pred             hc
Confidence            53



>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>KOG2785 consensus C2H2-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>KOG4173 consensus Alpha-SNAP protein [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1280 consensus Uncharacterized conserved protein containing ZZ-type Zn-finger [General function prediction only] Back     alignment and domain information
>KOG3982 consensus Runt and related transcription factors [Transcription] Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>KOG2482 consensus Predicted C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>KOG4377 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>PRK00464 nrdR transcriptional regulator NrdR; Validated Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information
>KOG2071 consensus mRNA cleavage and polyadenylation factor I/II complex, subunit Pcf11 [RNA processing and modification] Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG2893 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG1280 consensus Uncharacterized conserved protein containing ZZ-type Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2893 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG2482 consensus Predicted C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>KOG4173 consensus Alpha-SNAP protein [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>KOG2186 consensus Cell growth-regulating nucleolar protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG3982 consensus Runt and related transcription factors [Transcription] Back     alignment and domain information
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1883 consensus Cofactor required for Sp1 transcriptional activation, subunit 3 [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query432
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-09
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 8e-06
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-07
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-05
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-07
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-07
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-06
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-05
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-06
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-04
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-06
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 3e-06
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 4e-06
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 7e-06
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 7e-06
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-04
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 8e-06
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-04
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-05
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 3e-05
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-05
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 7e-05
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 4e-05
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 6e-05
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 9e-05
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 1e-04
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-04
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-04
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-04
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-04
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 3e-04
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 4e-04
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 4e-04
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 5e-04
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 5e-04
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 6e-04
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
 Score = 54.4 bits (132), Expect = 2e-09
 Identities = 35/128 (27%), Positives = 56/128 (43%), Gaps = 26/128 (20%)

Query: 64  FLCE--ICNKGFQRDQNLQLHRRGHNLPWKLKQRTNKEVRKKVYICPEKSCVHHDPSRAL 121
           F+C    CNK + +  +LQ+H R H         T +    K Y C  K C      R  
Sbjct: 7   FMCAYPGCNKRYFKLSHLQMHSRKH---------TGE----KPYQCDFKDC-----ERRF 48

Query: 122 GDLTGIKKHFSRKH-GEKKWKCEKCSKKYAVQSDWKAHSKI-CGTREYRC---DCGTLFS 176
                +K+H  R+H G K ++C+ C +K++     K H++   G + + C    C   F+
Sbjct: 49  SRSDQLKRH-QRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFA 107

Query: 177 RKDSFITH 184
           R D  + H
Sbjct: 108 RSDELVRH 115


>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query432
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.97
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.95
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.94
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.92
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.92
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.89
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.89
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.89
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.88
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.88
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.88
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.87
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.86
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.86
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.85
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.83
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.78
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.77
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.77
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.77
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.76
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.74
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.74
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.73
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.73
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.73
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.71
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.7
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.69
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.69
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.69
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.67
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.66
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.66
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.63
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.63
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.63
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.62
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.6
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.6
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.59
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.57
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.57
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.56
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.55
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.54
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.52
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.52
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.51
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.5
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.49
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.49
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.48
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.48
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.47
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.46
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.45
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.44
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.41
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.4
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.39
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.39
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.38
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.37
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.36
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.36
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.34
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.34
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.34
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.33
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.32
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.32
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.31
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.29
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.28
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.26
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.24
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.22
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.21
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.19
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.18
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.17
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.16
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.16
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.16
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.16
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.16
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.16
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.16
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.16
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.16
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.16
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.15
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.15
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.15
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.15
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.15
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.15
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.15
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.15
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.15
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.15
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.15
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.15
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.15
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.15
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.15
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.15
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.14
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.14
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.14
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.14
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.14
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.14
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.14
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.14
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.14
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.14
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.14
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.14
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.13
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.13
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.13
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.13
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.13
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.13
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.13
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.12
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.12
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.09
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.08
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.08
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.06
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.05
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.05
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.05
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.05
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.04
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.04
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.04
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.03
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.03
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.03
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.03
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.02
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.02
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.02
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.02
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.02
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.02
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.02
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.02
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.02
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.01
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.01
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.01
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.01
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.01
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.01
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.0
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.0
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.0
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.0
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.0
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.0
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.99
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.99
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.99
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.99
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.99
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.99
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.99
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.99
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.99
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.98
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.98
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.98
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.98
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.98
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.98
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.98
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.98
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.98
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.98
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.98
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.98
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 98.97
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.97
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.97
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.97
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.97
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.97
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.97
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.97
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.97
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 98.97
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.97
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.97
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.97
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.97
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.97
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.96
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.96
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.96
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.96
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.96
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.96
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.95
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.95
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.95
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.95
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.95
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.95
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.94
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.94
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.94
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.94
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.94
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.94
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.94
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.94
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.94
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.94
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.93
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.93
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.92
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.92
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.92
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.92
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.92
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.92
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.91
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.91
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.87
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.86
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.85
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.85
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.84
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.84
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.83
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.83
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.83
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.83
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.83
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.82
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.82
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.82
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.82
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.82
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.82
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.81
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.81
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.81
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.81
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.81
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.8
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.8
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.8
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.8
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.8
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.79
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.79
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.79
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.78
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.78
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.78
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.78
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.76
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.76
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.75
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.75
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.75
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.75
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.75
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.74
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.74
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.74
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.73
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.73
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.72
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.72
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.7
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.7
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.67
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.66
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.66
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.66
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.63
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.63
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.6
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.59
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.57
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.57
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.53
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.52
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.51
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.49
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.41
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.38
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.37
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.37
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.37
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.36
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.35
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.34
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.33
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.31
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.29
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.28
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.27
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.25
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.2
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.2
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.19
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.19
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.12
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.12
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.11
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.1
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.08
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.08
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.08
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.06
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.05
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.05
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.03
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.26
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.0
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.0
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.98
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.98
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.96
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.93
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.16
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.16
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.92
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.92
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.91
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.91
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.91
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 97.9
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.88
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.88
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.86
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.84
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.83
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.77
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.75
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.73
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.71
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.7
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 97.7
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.69
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.68
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.67
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.66
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.65
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.63
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.63
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.62
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.6
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.5
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 96.62
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 96.58
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.44
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.38
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.36
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.33
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.29
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.13
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 96.96
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.67
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.07
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.66
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.27
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 95.24
2e72_A49 POGO transposable element with ZNF domain; zinc fi 94.81
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 94.53
2e72_A49 POGO transposable element with ZNF domain; zinc fi 94.46
2k5c_A95 Uncharacterized protein PF0385; structural genomic 88.1
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 87.99
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 86.38
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 82.94
4ayb_P48 DNA-directed RNA polymerase; transferase, multi-su 82.62
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 80.27
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 80.22
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=99.97  E-value=2.2e-32  Score=249.04  Aligned_cols=169  Identities=24%  Similarity=0.512  Sum_probs=142.6

Q ss_pred             CCCCCCCCCCCCCcCcCCCCCCCCCCCCCCCCCcCCCCCCCCCCChhhhhcCccccCCCCceecccccccccChHHHHHH
Q 014041            3 SQDHGLSVPSTLKGFVQEPNSNPNPNPSSNQLKRKRNLPGTPDPDAEVIALSPKSLMATNRFLCEICNKGFQRDQNLQLH   82 (432)
Q Consensus         3 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~~c~~cg~~~~~~~~l~~h~~~h~~~k~f~C~~Cgk~F~~~~~L~~H   82 (432)
                      +++++|.|+.|++.|.....+..|...+.++++|+|+.|++.|.....|..|++.|.++++|+|++|++.|.....|..|
T Consensus        17 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H   96 (190)
T 2i13_A           17 PGEKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAH   96 (190)
T ss_dssp             --------------CCSSHHHHHGGGCC---CCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHHHHHH
T ss_pred             CCCCCCcCCCCccccCCHHHHHHHHHHcCCCCCccCCCcCchhCCHHHHHHHHHhcCCCCCccCcccCCccCCHHHHHHH
Confidence            45667999999999998887878888888889999999999999999999999999999999999999999999999999


Q ss_pred             HHhcCCCcccccccccccCCcceeCCCCCCCCCCCCCccCCHHHHHHHHhhhcCCCcccccccccccCChHHhhhhhcc-
Q 014041           83 RRGHNLPWKLKQRTNKEVRKKVYICPEKSCVHHDPSRALGDLTGIKKHFSRKHGEKKWKCEKCSKKYAVQSDWKAHSKI-  161 (432)
Q Consensus        83 ~r~H~~~~~~~~~~~~~~~~k~y~C~~C~c~~~~c~k~f~~~~~L~~H~~~H~gekp~~C~~C~k~F~~~~~L~~H~~~-  161 (432)
                      ++.|+             ++++|.|++|       ++.|.+...|..|+++|+++++|+|++|++.|.....|..|+++ 
T Consensus        97 ~~~h~-------------~~~~~~C~~C-------~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~H  156 (190)
T 2i13_A           97 QRTHT-------------GEKPYACPEC-------GKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTH  156 (190)
T ss_dssp             HHHHH-------------TCCCEECTTT-------CCEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHHHHHHHHHH
T ss_pred             HHhcC-------------CCCCCcCCCC-------CCccCCHHHHHHHHHHhCCCCCeECCCCCcccCCHHHHHHHHHhc
Confidence            99998             8899999999       99999999999999999999999999999999999999999999 


Q ss_pred             cCCcceeec-CCCccCCchHHHHHHHHhccc
Q 014041          162 CGTREYRCD-CGTLFSRKDSFITHRAFCDAL  191 (432)
Q Consensus       162 ~~~k~~~C~-C~~~F~~~~~L~~H~~~h~~~  191 (432)
                      +++++|.|+ |++.|.++..|..|+++|++.
T Consensus       157 ~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~  187 (190)
T 2i13_A          157 TGEKPYKCPECGKSFSRRDALNVHQRTHTGK  187 (190)
T ss_dssp             HCCCCEECTTTCCEESSHHHHHHHHTTC---
T ss_pred             CCCCCeECCCCCCccCCHHHHHHHHHhcCCC
Confidence            899999999 999999999999999998764



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 432
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 0.002
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 34.3 bits (78), Expect = 0.002
 Identities = 11/51 (21%), Positives = 18/51 (35%), Gaps = 3/51 (5%)

Query: 137 EKKWKCEKCSKKYAVQSDWKAHSKICGTREYRC--DCGTLFSRKDSFITHR 185
           +K + C+ C K +  +S    H  +           CG  F  K   + H 
Sbjct: 1   DKLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHM 50


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query432
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.49
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.46
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.1
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.07
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.01
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.0
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.99
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.96
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.94
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.88
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.87
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.86
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.86
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.79
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.78
d2cota238 Zinc finger and SCAN domain-containing protein 16, 98.76
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.74
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.73
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.73
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.71
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.7
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.61
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.6
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.52
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.52
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.47
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.45
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.43
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.43
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.38
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.34
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.33
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.31
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.31
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.31
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.3
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.26
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.26
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.12
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.09
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.0
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.96
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.91
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.88
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.8
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.78
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.46
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.42
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.36
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.3
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.3
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.29
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.24
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.21
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.12
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.08
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.05
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.89
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 96.88
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 96.86
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.85
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 96.85
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.82
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.8
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.71
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.58
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.51
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.51
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.48
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.47
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 96.41
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.25
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.24
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.22
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.22
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 96.21
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.14
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.07
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 95.96
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.83
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.78
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 95.55
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 95.53
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.38
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.36
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.31
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.06
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 94.98
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 94.52
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 94.25
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 93.78
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 93.74
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 93.71
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 93.54
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 92.86
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 92.37
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 92.26
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 92.16
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 91.07
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 90.94
d1y0jb136 U-shaped transcription factor, different fingers { 89.54
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 89.22
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 88.44
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 87.2
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 86.59
d2glia132 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 85.5
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 84.64
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 83.56
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 83.23
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 82.7
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 82.37
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 82.29
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 82.08
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 81.75
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 81.67
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 81.01
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 80.18
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.49  E-value=9.7e-15  Score=103.09  Aligned_cols=53  Identities=17%  Similarity=0.305  Sum_probs=34.9

Q ss_pred             CCceecccccccccChHHHHHHHHhcCCCcccccccccccCCcceeCCCCCCCCCCCCCccCCHHHHHHHHhhh
Q 014041           61 TNRFLCEICNKGFQRDQNLQLHRRGHNLPWKLKQRTNKEVRKKVYICPEKSCVHHDPSRALGDLTGIKKHFSRK  134 (432)
Q Consensus        61 ~k~f~C~~Cgk~F~~~~~L~~H~r~H~~~~~~~~~~~~~~~~k~y~C~~C~c~~~~c~k~f~~~~~L~~H~~~H  134 (432)
                      ||||+|+ |||.|..+..|..|+++|+             +++||.|++|       ++.|.....|..|+++|
T Consensus         1 EK~y~C~-Cgk~F~~~~~l~~H~~~Ht-------------~ekpy~C~~C-------~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPCQ-CGKSFTHKSQRDRHMSMHL-------------GLRPYGCGVC-------GKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEECT-TSCEESSHHHHHHHHHHHS-------------CCCSEECTTT-------SCEESSSHHHHHHHTTT
T ss_pred             CcCCCCC-CCCeECCHHHhHHHhhccc-------------cccCCcCCCc-------CCEecCHHHHHHHHhcC
Confidence            4566663 6666666666666666666             6666666666       66666666666666655



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia1 g.37.1.1 (A:103-134) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure