BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 014095
         (431 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3BJS|A Chain A, Crystal Structure Of A Member Of Enolase Superfamily From
           Polaromonas Sp. Js666
 pdb|3BJS|B Chain B, Crystal Structure Of A Member Of Enolase Superfamily From
           Polaromonas Sp. Js666
          Length = 428

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 27/48 (56%)

Query: 247 KTLLFFQGNTIRKDEGKVRAKLAKILTGYDDVHYERSAPTTKSIKEST 294
           KT+    G+TI++D   +R + ++ +TGY + H  RS     S+  +T
Sbjct: 57  KTVTMGVGSTIKRDAIIIRVETSEGITGYGEAHPGRSPGAITSLIHNT 104


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.136    0.420 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 13,270,001
Number of Sequences: 62578
Number of extensions: 553693
Number of successful extensions: 999
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 998
Number of HSP's gapped (non-prelim): 1
length of query: 431
length of database: 14,973,337
effective HSP length: 102
effective length of query: 329
effective length of database: 8,590,381
effective search space: 2826235349
effective search space used: 2826235349
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 53 (25.0 bits)