Citrus Sinensis ID: 014118


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430
MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLEENKVAENSFVVVMLTKSKVSSSGASTVSAAPANQAQTTSSAPPTSTQPTTTSQTPAPTVAPPQSVPESAPPPAAPAPAPAPAPAPAPAPAPVSSVSDVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYLYSGIPEQTAVPPVARASAGGQAGNPPAQTQAQQPAAPAPTSGPNANPLDLFPQGLPNMGSNAGAGTLDFLRNSQQVSMMFYLFASLLFICDVFWYSYFRLLFQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEPVEGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
cEEEEEcccccEEEEEEcccccHHHHHHHHHHHccccccccccEEEEECcccccccccHHHcccccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccHHHHHHHHHHcccccccHHHHHHHHHHHHccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHcccccccc
MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLEENKVAENSFVVVMLT*******************************************************************************************VAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYLYSGI****************************************************************************************FWYSYFRLLFQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEP*******************VTV*****EAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLEENKVAENSFVVVMLTKSKVSSSGASTVSAAPANQAQTTSSAPPTSTQPTTTSQTPAPTVAPPQSVPESAPPPAAPAPAPAPAPAPAPAPAPVSSVSDVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYLYSGIPEQTAVPPVARASAGGQAGNPPAQTQAQQPAAPAPTSGPNANPLDLFPQGLPNMGSNAGAGTLDFLRNSQQVSMMFYLFASLLFICDVFWYSYFRLLFQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEPVEGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable DNA repair protein RAD23 May be involved in nucleotide excision repair.probableQ40742
Putative DNA repair protein RAD23-3 May be involved in nucleotide excision repair.probableQ84L31
UV excision repair protein rhp23 Protects ubiquitin chains against dissambly by deubiquitinating enzymes thereby promoting protein degradation.probableO74803

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OQY, chain A
Confidence level:very confident
Coverage over the Query: 1-251,268-284,313-429
View the alignment between query and template
View the model in PyMOL
Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 144-156
View the alignment between query and template
View the model in PyMOL