Citrus Sinensis ID: 014176

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------43

MSDKCLVRTLGTPEFMAPELYEEDYNELVDIYSFGMCVLEMLTSEYPYSECSNPAQIYKKVTSGKLPGAFHRIQDAEARRFVGKCLENVSKRLPAKELLLDPFLASDAGEPLLIPQVPSFQNLNPNGAVMELVPKFAVDSDRRKSTDMTITGTMNPEDDTIFLKVQITDKDGQARNIYFPFDIFNDTATEVALEMVKELEITDWEPLEIAEMIEQEISSLVPNWKECGSPQFCHQHSFSYEDEDDDNDDDGIYHPFYSNSSHSSSHASLPAFFTNNANSPPSWLQQEDLLGNDDASSNGSVSSFKYSSWDYHSGNEDDSEFSHRAGEPLCIARATQKSTRFCPEAAMNNDRCNSEDVNSRKACRSNSNNHRKLSRIRSLVDVRSQLLHRSLVEEIHKRRLFKTVGAVENIGFHEPANCAAYGRCPVSRS

cccccccEEccccccccccccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHcccccccccccccHHHHHHHHHHHccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccEEEEEEEEcccccccccccccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHcccccccccccccccccccccc

cccccEEEEEccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHcccccHHHHHHcccHHHHHHHHHHcccHHccccHHHHHcccHHcccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccEEEEEEEEEcccccEEEEEEEcccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHEccccccccccccccccccccc

msdkclvrtlgtpefmapelyeedYNELVDIYSFGMCVLEMltseypysecsnpaqIYKKVtsgklpgafhrIQDAEARRFVGKCLENVskrlpakellldpflasdagepllipqvpsfqnlnpngavmelvpkfavdsdrrkstdmtitgtmnpeddTIFLKVQitdkdgqarniyfpfdifnDTATEVALEMVKEleitdweplEIAEMIEQEISSlvpnwkecgspqfchqhsfsyededddndddgiyhpfysnsshssshaslpafftnnansppswlqqedllgnddassngsvssfkysswdyhsgneddsefshrageplCIARATqkstrfcpeaamnndrcnsedvnsrkacrsnsnnhrklsRIRSLVDVRSQLLHRSLVEEIHKRRlfktvgavenigfhepancaaygrcpvsrs

msdkclvrtlgtpefmapeLYEEDYNELVDIYSFGMCVLEMLTSEYPYSECSNPAQIYKKVTSGKLPGAFHRIQDAEARRFVGKCLENVSKRLPAKELLLDPFLASDAGEPLLIPQVPSFQNLNPNGAVMELVPkfavdsdrrkstdmtitgtmnpeddtiFLKVQITDKDGQARNIYFPFDIFNDTATEVALEMVKELEITDWEPLEIAEMIEQEISSLVPNWKECGSPQFCHQHSFSYEDEDDDNDDDGIYHPFYSNSSHSSSHASLPAFFTNNANSPPSWLQQEDLLGNDDASSNGSVSSFKYSSWDYHSGNEDDSEFSHRAGEPLCIARATQKSTRFCPEaamnndrcnsedvnsrkacrsnsnnhrklsrirslvdVRSQLLHRslveeihkrrlFKTVGAvenigfhepancaaygrcpvsrs

MSDKCLVRTLGTPEFMAPELYEEDYNELVDIYSFGMCVLEMLTSEYPYSECSNPAQIYKKVTSGKLPGAFHRIQDAEARRFVGKCLENVSKRLPAKELLLDPFLASDAGEPLLIPQVPSFQNLNPNGAVMELVPKFAVDSDRRKSTDMTITGTMNPEDDTIFLKVQITDKDGQARNIYFPFDIFNDTATEVALEMVKELEITDWEPLEIAEMIEQEISSLVPNWKECGSPQFCHQHSFSYededddndddGIYHPFYsnsshssshasLPAFFTNNANSPPSWLQQEDLLGNDDASSNGSVSSFKYSSWDYHSGNEDDSEFSHRAGEPLCIARATQKSTRFCPEAAMNNDRCNSEDVNSRKACRSNSNNHRKLSRIRSLVDVRSQLLHRSLVEEIHKRRLFKTVGAVENIGFHEPANCAAYGRCPVSRS

****CLVRTLGTPEFMAPELYEEDYNELVDIYSFGMCVLEMLTSEYPYSECSNPAQIYKKVTSGKLPGAFHRIQDAEARRFVGKCLENVSKRLPAKELLLDPFLASDAGEPLLIPQVPSFQNLNPNGAVMELVPKFA********************DDTIFLKVQITDKDGQARNIYFPFDIFNDTATEVALEMVKELEITDWEPLEIAEMIEQEISSLVPNWKECGSPQFCHQHS******************************************************************************************************************************************IRSLVDVRSQLLHRSLVEEIHKRRLFKTVGAVENIGFHEPANCAAYGRC*****

*****LV***GTPEFMAPELYEEDYNELVDIYSFGMCVLEMLTSEYPYSECSNPAQIYKKVTSGKLPGAF*RIQDAEARRFVGKCLENVSKRLPAKELLLDPFLASDAG******************************************************KVQITDKDGQARNIYFPFDIFNDTATEVALEMVKELEITDWEPLEIAEMIEQEISSLV********************************************************************************************************************************************************************LLHRSLVEEIHKRRLFKTVGAVENIGFHEPANC***********

MSDKCLVRTLGTPEFMAPELYEEDYNELVDIYSFGMCVLEMLTSEYPYSECSNPAQIYKKVTSGKLPGAFHRIQDAEARRFVGKCLENVSKRLPAKELLLDPFLASDAGEPLLIPQVPSFQNLNPNGAVMELVPKFAVDSDRRKSTDMTITGTMNPEDDTIFLKVQITDKDGQARNIYFPFDIFNDTATEVALEMVKELEITDWEPLEIAEMIEQEISSLVPNWKECGSPQFCHQHSFSYEDEDDDNDDDGIYHPFYSNSSHSSSHASLPAFFTNNANSPPSWLQQEDLLGNDDASSNGSVSSFKYSSWDYHS*********HRAGEPLCIARATQKSTRFCPEAAMNND**********************LSRIRSLVDVRSQLLHRSLVEEIHKRRLFKTVGAVENIGFHEPANCAAYGRCPVSRS

**DKCLVRTLGTPEFMAPELYEEDYNELVDIYSFGMCVLEMLTSEYPYSECSNPAQIYKKVTSGKLPGAFHRIQDAEARRFVGKCLENVSKRLPAKELLLDPFLASDA************************************STDMTITGTMNPEDDTIFLKVQITDKDGQARNIYFPFDIFNDTATEVALEMVKELEITDWEPLEIAEMIEQEISSLVPNWK********************************************************SWLQQEDLLG************************************************************************************IRSLVDVRSQLLHRSLVEEIHKRRLFKTVGAVENIGFHEPANC***********

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		429	2.2.26 [Sep-21-2011]
Q9SCU5		549	Probable serine/threonine	yes	no	0.554	0.433	0.663	6e-89
Q9LVL5		571	Probable serine/threonine	no	no	0.853	0.640	0.467	2e-83
Q2RBE3		622	Probable serine/threonine	yes	no	0.557	0.384	0.547	6e-65
Q2QYL8		619	Probable serine/threonine	yes	no	0.557	0.386	0.549	2e-64
Q8S8Y9		568	Serine/threonine-protein	no	no	0.503	0.380	0.495	3e-59
Q0D598		704	Probable serine/threonine	no	no	0.529	0.322	0.461	5e-57
A2YMV6		704	Probable serine/threonine	N/A	no	0.529	0.322	0.461	6e-57
Q2V338		492	Probable serine/threonine	no	no	0.496	0.432	0.466	8e-53
Q65X23		621	Probable serine/threonine	no	no	0.489	0.338	0.449	6e-52
Q9STK6		516	Probable serine/threonine	no	no	0.475	0.395	0.515	4e-51

>sp\|Q9SCU5\|WNK5_ARATH Probable serine/threonine-protein kinase WNK5 OS=Arabidopsis thaliana GN=WNK5 PE=1 SV=2	Back alignment and function desciption

 Score =  328 bits (840), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 164/247 (66%), Positives = 188/247 (76%), Gaps = 9/247 (3%)

Query: 9   TLGTPEFMAPELYEEDYNELVDIYSFGMCVLEMLTSEYPYSECSNPAQIYKKVTSGKLPG 68
            +GTPEFMAPELYEEDYNELVDIYSFGMCVLEMLT EYPYSEC+NPAQIYKKVTSGKLP 
Sbjct: 188 VIGTPEFMAPELYEEDYNELVDIYSFGMCVLEMLTGEYPYSECTNPAQIYKKVTSGKLPD 247

Query: 69  AFHRIQDAEARRFVGKCLENVSKRLPAKELLLDPFLAS----DAGEPLLIPQVPSFQNLN 124
           +FH IQ  EA+RFVGKCLE VS+RLPAKELL DPFLA+    D      +PQ  + QNL 
Sbjct: 248 SFHLIQHTEAQRFVGKCLETVSRRLPAKELLADPFLAATDERDLAPLFRLPQQLAIQNLA 307

Query: 125 PNGAVMELVPKFAVDSDRRKSTDMTITGTMNPEDDTIFLKVQITDKDGQARNIYFPFDIF 184
            NG V+E +P     +D  ++TDM+ITG MN ED TIFL+VQI D DG  RNI FPF+I 
Sbjct: 308 ANGTVVEHLPS---TTDPTRTTDMSITGKMNSEDHTIFLQVQILDGDGHMRNIQFPFNIL 364

Query: 185 NDTATEVALEMVKELEITDWEPLEIAEMIEQEISSLVPNWKECGSPQFCHQHSFSYEDED 244
           +DT  EVALEMVKELEITDW+PLEIA MIE EIS LVPNW+   S       SF +ED++
Sbjct: 365 SDTPLEVALEMVKELEITDWDPLEIAAMIENEISLLVPNWRANDSS--IRHESFGHEDDE 422

Query: 245 DDNDDDG 251
           D+ D +G
Sbjct: 423 DNGDTEG 429

Regulates flowering time by modulating the photoperiod pathway.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1

>sp\|Q9LVL5\|WNK4_ARATH Probable serine/threonine-protein kinase WNK4 OS=Arabidopsis thaliana GN=WNK4 PE=1 SV=1	Back alignment and function description

>sp\|Q2RBE3\|WNK7_ORYSJ Probable serine/threonine-protein kinase WNK7 OS=Oryza sativa subsp. japonica GN=WNK7 PE=2 SV=2	Back alignment and function description

>sp\|Q2QYL8\|WNK8_ORYSJ Probable serine/threonine-protein kinase WNK8 OS=Oryza sativa subsp. japonica GN=WNK8 PE=2 SV=1	Back alignment and function description

>sp\|Q8S8Y9\|WNK2_ARATH Serine/threonine-protein kinase WNK2 OS=Arabidopsis thaliana GN=WNK2 PE=1 SV=1	Back alignment and function description

>sp\|Q0D598\|WNK1_ORYSJ Probable serine/threonine-protein kinase WNK1 OS=Oryza sativa subsp. japonica GN=WNK1 PE=2 SV=1	Back alignment and function description

>sp\|A2YMV6\|WNK1_ORYSI Probable serine/threonine-protein kinase WNK1 OS=Oryza sativa subsp. indica GN=WNK1 PE=2 SV=2	Back alignment and function description

>sp\|Q2V338\|WNK9_ARATH Probable serine/threonine-protein kinase WNK9 OS=Arabidopsis thaliana GN=WNK9 PE=2 SV=1	Back alignment and function description

>sp\|Q65X23\|WNK2_ORYSJ Probable serine/threonine-protein kinase WNK2 OS=Oryza sativa subsp. japonica GN=WNK2 PE=2 SV=1	Back alignment and function description

>sp\|Q9STK6\|WNK3_ARATH Probable serine/threonine-protein kinase WNK3 OS=Arabidopsis thaliana GN=WNK3 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		429
224140589		601	predicted protein [Populus trichocarpa]	0.925	0.660	0.635	1e-131
359481240		626	PREDICTED: probable serine/threonine-pro	0.925	0.634	0.610	1e-118
225434355		631	PREDICTED: probable serine/threonine-pro	0.902	0.613	0.578	1e-118
255584247		617	kinase, putative [Ricinus communis] gi\|2	0.923	0.641	0.613	1e-117
224124748		608	predicted protein [Populus trichocarpa]	0.895	0.631	0.563	1e-111
356496301		609	PREDICTED: probable serine/threonine-pro	0.925	0.651	0.553	1e-105
351721696		607	with no lysine kinase 5 [Glycine max] gi	0.920	0.650	0.555	1e-103
224145457		606	predicted protein [Populus trichocarpa]	0.888	0.628	0.536	1e-102
148469851		610	WNK1 [Glycine max]	0.927	0.652	0.546	1e-102
449531499		579	PREDICTED: probable serine/threonine-pro	0.916	0.678	0.502	1e-101

>gi\|224140589\|ref\|XP_002323664.1\| predicted protein [Populus trichocarpa] gi\|222868294\|gb\|EEF05425.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  475 bits (1223), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 260/409 (63%), Positives = 312/409 (76%), Gaps = 12/409 (2%)

Query: 9   TLGTPEFMAPELYEEDYNELVDIYSFGMCVLEMLTSEYPYSECSNPAQIYKKVTSGKLPG 68
            +GTPEFMAPELYEEDY+ELVDIYSFGMCVLEMLT EYPYSECSNPAQIYKKVTSGKLP 
Sbjct: 192 VIGTPEFMAPELYEEDYDELVDIYSFGMCVLEMLTFEYPYSECSNPAQIYKKVTSGKLPE 251

Query: 69  AFHRIQDAEARRFVGKCLENVSKRLPAKELLLDPFLASDAGEPLLIPQVPSFQNLNPNGA 128
           AF+RI+D EA+ F+GKCL   SKRLPA+ELLLDPFLASD  E   IP+VPS  + +P   
Sbjct: 252 AFYRIEDVEAQEFIGKCLATASKRLPARELLLDPFLASDEAELGTIPKVPSPWS-SPKVT 310

Query: 129 VMELVPKFAVDSDRRKSTDMTITGTMNPEDDTIFLKVQITDKDGQARNIYFPFDIFNDTA 188
             +++P    D    K+T+MT+TGTMNP+DDTIFLKV+I++KDGQ RNIYFPFDI NDTA
Sbjct: 311 EEKIMPSLLADPT--KATEMTVTGTMNPQDDTIFLKVKISEKDGQTRNIYFPFDIMNDTA 368

Query: 189 TEVALEMVKELEITDWEPLEIAEMIEQEISSLVPNWKECGSPQFCH-QHSFSYEDEDDDN 247
            +VA+EMVKELEITDWEP EIA+MIE++ISSL+P WK+C S Q  H QH FSYED+DDD+
Sbjct: 369 IDVAMEMVKELEITDWEPFEIADMIEEQISSLIPGWKQCSSSQIHHPQHCFSYEDDDDDD 428

Query: 248 DDDGIYHPFYSNSSHSSSHASLPAFFTNNANSPPSWLQQEDLLGNDDASSNGSVSSFKYS 307
            +DG  HPF+++SSHSSS ASL AF  +    P       +L  +DDASS  S++SFKYS
Sbjct: 429 HNDGPRHPFFASSSHSSSQASLLAFNCSFQTKPC------ELFIDDDASSQSSLNSFKYS 482

Query: 308 SWDYHSGNEDDSEFSHRAGEPLCIARATQKSTRFCPEAAMNNDRCNSEDVNSRKACRSNS 367
           + +Y SGNEDD + S R   PL   +   KSTRFCP  +++  +    +         +S
Sbjct: 483 TLNYSSGNEDDYDASLRE-VPLGFGK-IHKSTRFCPADSLSAKQYKHRNARLDSGGCCSS 540

Query: 368 NNHRKLSRIRSLVDVRSQLLHRSLVEEIHKRRLFKTVGAVENIGFHEPA 416
           N  RKLSRIRS VDVR+QLLHRSL+EEI+KRRLFKTVGAVENIG+HEP 
Sbjct: 541 NPQRKLSRIRSQVDVRNQLLHRSLLEEINKRRLFKTVGAVENIGYHEPG 589

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|359481240\|ref\|XP_002266913.2\| PREDICTED: probable serine/threonine-protein kinase WNK5-like [Vitis vinifera] gi\|297735557\|emb\|CBI18051.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225434355\|ref\|XP_002268300.1\| PREDICTED: probable serine/threonine-protein kinase WNK4 [Vitis vinifera] gi\|297745773\|emb\|CBI15829.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255584247\|ref\|XP_002532861.1\| kinase, putative [Ricinus communis] gi\|223527373\|gb\|EEF29515.1\| kinase, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|224124748\|ref\|XP_002319412.1\| predicted protein [Populus trichocarpa] gi\|222857788\|gb\|EEE95335.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356496301\|ref\|XP_003517007.1\| PREDICTED: probable serine/threonine-protein kinase WNK5-like [Glycine max]	Back alignment and taxonomy information

>gi\|351721696\|ref\|NP_001237474.1\| with no lysine kinase 5 [Glycine max] gi\|225348639\|gb\|ACN87281.1\| with no lysine kinase [Glycine max]	Back alignment and taxonomy information

>gi\|224145457\|ref\|XP_002325649.1\| predicted protein [Populus trichocarpa] gi\|222862524\|gb\|EEF00031.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|148469851\|gb\|ABQ65855.1\| WNK1 [Glycine max]	Back alignment and taxonomy information

>gi\|449531499\|ref\|XP_004172723.1\| PREDICTED: probable serine/threonine-protein kinase WNK5-like, partial [Cucumis sativus]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		429
TAIR\|locus:2161278		571	WNK4 "with no lysine (K) kinas	0.515	0.387	0.574	4e-83
TAIR\|locus:2098242		549	WNK5 "with no lysine (K) kinas	0.701	0.548	0.564	2.3e-78
TAIR\|locus:2114845		700	WNK1 "with no lysine (K) kinas	0.235	0.144	0.673	1.9e-53
TAIR\|locus:2182039		492	WNK9 [Arabidopsis thaliana (ta	0.235	0.205	0.643	1.8e-52
TAIR\|locus:504955638		516	WNK3 "with no lysine (K) kinas	0.477	0.397	0.513	5.2e-49
TAIR\|locus:2093994		567	WNK6 "with no lysine (K) kinas	0.251	0.190	0.603	4.8e-45
TAIR\|locus:2028521		557	WNK7 [Arabidopsis thaliana (ta	0.251	0.193	0.585	5.5e-44
TAIR\|locus:2165790		563	WNK8 "with no lysine (K) kinas	0.310	0.236	0.543	3.6e-42
ZFIN\|ZDB-GENE-030131-2656		1909	wnk1b "WNK lysine deficient pr	0.233	0.052	0.544	3.8e-34
UNIPROTKB\|D4A5L1		2056	Wnk2 "Protein Wnk2" [Rattus no	0.233	0.048	0.564	7.1e-33

TAIR\|locus:2161278 WNK4 "with no lysine (K) kinase 4" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 646 (232.5 bits), Expect = 4.0e-83, Sum P(2) = 4.0e-83
 Identities = 131/228 (57%), Positives = 167/228 (73%)

Query:    10 LGTPEFMAPELYEEDYNELVDIYSFGMCVLEMLTSEYPYSECSNPAQIYKKVTSGKLPGA 69
             +GTPEFMAPELYEE+YNEL+D+YSFGMC LEM+TSE+PYSEC++PAQIYKKV  GKLPGA
Sbjct:   183 IGTPEFMAPELYEENYNELIDVYSFGMCFLEMITSEFPYSECNHPAQIYKKVVGGKLPGA 242

Query:    70 FHRIQDAEARRFVGKCLENVSKRLPAKELLLDPFLASDAGEPLLIPQVPSFQNLNPNGAV 129
             F+R+ D EA+RF+GKCL + SKR+ AKELL DPFLASD  E  ++    S    NP   +
Sbjct:   243 FYRVGDIEAQRFIGKCLVSASKRVSAKELLQDPFLASD--ESWMV--YTSGAG-NPKPFL 297

Query:   130 MEL-VPKFAVDSDRRKSTDMTITGTMNPEDDTIFLKVQITDKDGQARNIYFPFDIFNDTA 188
              E  +    ++ D  + T+M+I G +  ED+ I L+VQI   +G A N++FPFDI NDT+
Sbjct:   298 NENEMDTLKLEDDELR-TEMSIAGKLGAEDNKIDLEVQIAYDNGLANNVFFPFDIMNDTS 356

Query:   189 TEVALEMVKELEITDWEPLEIAEMIEQEISSLVPNWKECGSPQFCHQH 236
              +VA EMVKELEI DWEP+EIA+MI+  ISSLV +WK     +  H H
Sbjct:   357 IDVAKEMVKELEIIDWEPVEIAKMIDGAISSLVSDWKYEEDDETPHDH 404

GO:0004672 "protein kinase activity" evidence=IEA;TAS

GO:0004674 "protein serine/threonine kinase activity" evidence=IEA;IDA

GO:0005524 "ATP binding" evidence=IEA

GO:0005737 "cytoplasm" evidence=ISM;IDA

GO:0006468 "protein phosphorylation" evidence=IEA;TAS

GO:0016301 "kinase activity" evidence=ISS

GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA

GO:0005634 "nucleus" evidence=IDA

GO:0046777 "protein autophosphorylation" evidence=IDA

GO:0010260 "organ senescence" evidence=RCA

GO:0016036 "cellular response to phosphate starvation" evidence=RCA

GO:0019375 "galactolipid biosynthetic process" evidence=RCA

GO:0042631 "cellular response to water deprivation" evidence=RCA

TAIR\|locus:2098242 WNK5 "with no lysine (K) kinase 5" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2114845 WNK1 "with no lysine (K) kinase 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2182039 WNK9 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:504955638 WNK3 "with no lysine (K) kinase 3" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2093994 WNK6 "with no lysine (K) kinase 6" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2028521 WNK7 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2165790 WNK8 "with no lysine (K) kinase 8" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-030131-2656 wnk1b "WNK lysine deficient protein kinase 1b" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|D4A5L1 Wnk2 "Protein Wnk2" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		429
smart00220		254	smart00220, S_TKc, Serine/Threonine protein kinase	1e-19
cd06606		260	cd06606, STKc_MAPKKK, Catalytic domain of the Prot	2e-19
cd06632		258	cd06632, STKc_MEKK1_plant, Catalytic domain of the	9e-16
cd05122		253	cd05122, PKc_STE, Catalytic domain of STE family P	2e-15
cd06626		264	cd06626, STKc_MEKK4, Catalytic domain of the Prote	3e-15
cd06614		286	cd06614, STKc_PAK, Catalytic domain of the Protein	5e-15
pfam00069		260	pfam00069, Pkinase, Protein kinase domain	2e-14
cd05123		250	cd05123, STKc_AGC, Catalytic domain of AGC family	6e-11
cd06648		285	cd06648, STKc_PAK_II, Catalytic domain of the Prot	8e-11
cd06623		264	cd06623, PKc_MAPKK_plant_like, Catalytic domain of	2e-10
cd05580		290	cd05580, STKc_PKA, Catalytic domain of the Protein	2e-10
cd06610		267	cd06610, STKc_OSR1_SPAK, Catalytic domain of the P	2e-10
cd06624		268	cd06624, STKc_ASK, Catalytic domain of the Protein	2e-10
cd06917		277	cd06917, STKc_NAK1_like, Catalytic domain of Funga	4e-10
cd06647		293	cd06647, STKc_PAK_I, Catalytic domain of the Prote	5e-10
cd06609		274	cd06609, STKc_MST3_like, Catalytic domain of Mamma	8e-10
cd06612		256	cd06612, STKc_MST1_2, Catalytic domain of the Prot	9e-10
cd06651		266	cd06651, STKc_MEKK3, Catalytic domain of the Prote	2e-09
cd06630		268	cd06630, STKc_MEKK1, Catalytic domain of the Prote	2e-09
cd06655		296	cd06655, STKc_PAK2, Catalytic domain of the Protei	5e-09
cd06625		263	cd06625, STKc_MEKK3_like, Catalytic domain of MAP/	5e-09
cd06628		267	cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o	5e-09
cd06611		280	cd06611, STKc_SLK_like, Catalytic domain of Ste20-	1e-08
cd06656		297	cd06656, STKc_PAK3, Catalytic domain of the Protei	1e-08
cd05572		262	cd05572, STKc_cGK_PKG, Catalytic domain of the Pro	2e-08
cd08215		258	cd08215, STKc_Nek, Catalytic domain of the Protein	2e-08
cd06643		282	cd06643, STKc_SLK, Catalytic domain of the Protein	2e-08
cd06659		297	cd06659, STKc_PAK6, Catalytic domain of the Protei	6e-08
cd05579		265	cd05579, STKc_MAST_like, Catalytic domain of Micro	7e-08
cd06657		292	cd06657, STKc_PAK4, Catalytic domain of the Protei	1e-07
COG0515		384	COG0515, SPS1, Serine/threonine protein kinase [Ge	1e-07
cd06617		283	cd06617, PKc_MKK3_6, Catalytic domain of the dual-	1e-07
cd06654		296	cd06654, STKc_PAK1, Catalytic domain of the Protei	2e-07
cd08217		265	cd08217, STKc_Nek2, Catalytic domain of the Protei	3e-07
cd05612		291	cd05612, STKc_PRKX_like, Catalytic domain of PRKX-	5e-07
cd06652		265	cd06652, STKc_MEKK2, Catalytic domain of the Prote	5e-07
cd06618		296	cd06618, PKc_MKK7, Catalytic domain of the dual-sp	5e-07
cd06605		265	cd06605, PKc_MAPKK, Catalytic domain of the dual-s	5e-07
cd05581		280	cd05581, STKc_PDK1, Catalytic domain of the Protei	7e-07
cd05583		288	cd05583, STKc_MSK_N, N-terminal catalytic domain o	1e-06
cd00180		215	cd00180, PKc, Catalytic domain of Protein Kinases	2e-06
PTZ00263		329	PTZ00263, PTZ00263, protein kinase A catalytic sub	2e-06
cd06653		264	cd06653, STKc_MEKK3_like_1, Catalytic domain of MA	2e-06
cd06658		292	cd06658, STKc_PAK5, Catalytic domain of the Protei	3e-06
cd06629		272	cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o	3e-06
cd08529		256	cd08529, STKc_FA2-like, Catalytic domain of the Pr	3e-06
cd06627		254	cd06627, STKc_Cdc7_like, Catalytic domain of Cell	3e-06
cd05611		260	cd05611, STKc_Rim15_like, Catalytic domain of fung	5e-06
cd05578		258	cd05578, STKc_Yank1, Catalytic domain of the Prote	6e-06
cd06622		286	cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of	7e-06
cd05589		324	cd05589, STKc_PKN, Catalytic domain of the Protein	1e-05
cd05628		363	cd05628, STKc_NDR1, Catalytic domain of the Protei	2e-05
cd05573		350	cd05573, STKc_ROCK_NDR_like, Catalytic domain of R	2e-05
cd06631		265	cd06631, STKc_YSK4, Catalytic domain of the Protei	2e-05
cd05627		360	cd05627, STKc_NDR2, Catalytic domain of the Protei	3e-05
cd05592		316	cd05592, STKc_nPKC_theta_delta, Catalytic domain o	4e-05
cd08223		257	cd08223, STKc_Nek4, Catalytic domain of the Protei	4e-05
cd06644		292	cd06644, STKc_STK10_LOK, Catalytic domain of the P	4e-05
cd06613		262	cd06613, STKc_MAP4K3_like, Catalytic domain of Mit	5e-05
cd08220		256	cd08220, STKc_Nek8, Catalytic domain of the Protei	5e-05
cd08530		256	cd08530, STKc_CNK2-like, Catalytic domain of the P	1e-04
cd05570		318	cd05570, STKc_PKC, Catalytic domain of the Protein	1e-04
cd08224		267	cd08224, STKc_Nek6_Nek7, Catalytic domain of the P	1e-04
cd05599		364	cd05599, STKc_NDR_like, Catalytic domain of Nuclea	1e-04
cd06641		277	cd06641, STKc_MST3, Catalytic domain of the Protei	1e-04
cd05586		330	cd05586, STKc_Sck1_like, Catalytic domain of Suppr	2e-04
cd08221		256	cd08221, STKc_Nek9, Catalytic domain of the Protei	2e-04
cd06608		275	cd06608, STKc_myosinIII_like, Catalytic domain of	2e-04
cd05585		312	cd05585, STKc_YPK1_like, Catalytic domain of Yeast	3e-04
cd06640		277	cd06640, STKc_MST4, Catalytic domain of the Protei	4e-04
cd06639		291	cd06639, STKc_myosinIIIB, Catalytic domain of the	5e-04
cd06619		279	cd06619, PKc_MKK5, Catalytic domain of the dual-sp	6e-04
cd05584		323	cd05584, STKc_p70S6K, Catalytic domain of the Prot	7e-04
cd05595		323	cd05595, STKc_PKB_beta, Catalytic domain of the Pr	9e-04
cd05608		280	cd05608, STKc_GRK1, Catalytic domain of the Protei	0.001
pfam07714		258	pfam07714, Pkinase_Tyr, Protein tyrosine kinase	0.001
cd06642		277	cd06642, STKc_STK25-YSK1, Catalytic domain of the	0.001
cd08222		260	cd08222, STKc_Nek11, Catalytic domain of the Prote	0.001
cd06620		284	cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of	0.001
cd00192		262	cd00192, PTKc, Catalytic domain of Protein Tyrosin	0.001
cd08218		256	cd08218, STKc_Nek1, Catalytic domain of the Protei	0.001
cd05046		275	cd05046, PTK_CCK4, Pseudokinase domain of the Prot	0.002
cd05600		333	cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun	0.002
cd05619		316	cd05619, STKc_nPKC_theta, Catalytic domain of the	0.002
cd05594		325	cd05594, STKc_PKB_alpha, Catalytic domain of the P	0.002
cd06615		308	cd06615, PKc_MEK, Catalytic domain of the dual-spe	0.002
cd05571		323	cd05571, STKc_PKB, Catalytic domain of the Protein	0.002
cd08229		267	cd08229, STKc_Nek7, Catalytic domain of the Protei	0.002
cd05613		290	cd05613, STKc_MSK1_N, N-terminal catalytic domain	0.002
PRK13184		932	PRK13184, pknD, serine/threonine-protein kinase; R	0.002
cd05593		328	cd05593, STKc_PKB_gamma, Catalytic domain of the P	0.002
cd05575		323	cd05575, STKc_SGK, Catalytic domain of the Protein	0.002
cd05626		381	cd05626, STKc_LATS2, Catalytic domain of the Prote	0.003
cd05629		377	cd05629, STKc_NDR_like_fungal, Catalytic domain of	0.003
PLN00034		353	PLN00034, PLN00034, mitogen-activated protein kina	0.003
PTZ00426		340	PTZ00426, PTZ00426, cAMP-dependent protein kinase	0.004
cd05590		320	cd05590, STKc_nPKC_eta, Catalytic domain of the Pr	0.004
smart00750		176	smart00750, KIND, kinase non-catalytic C-lobe doma	0.004
smart00219		257	smart00219, TyrKc, Tyrosine kinase, catalytic doma	0.004

>gnl\|CDD\|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain	Back alignment and domain information

 Score = 87.6 bits (218), Expect = 1e-19
 Identities = 36/98 (36%), Positives = 52/98 (53%), Gaps = 5/98 (5%)

Query: 11  GTPEFMAPE-LYEEDYNELVDIYSFGMCVL-EMLTSEYPYSECSNPAQIYKKVTSGKLPG 68
           GTPE+MAPE L  + Y + VDI+S G  +L E+LT + P+       +++KK+   K P 
Sbjct: 158 GTPEYMAPEVLLGKGYGKAVDIWSLG-VILYELLTGKPPFPGDDQLLELFKKIGKPKPPF 216

Query: 69  AFHRIQ-DAEARRFVGKCLE-NVSKRLPAKELLLDPFL 104
                    EA+  + K L  +  KRL A+E L  PF 
Sbjct: 217 PPPEWDISPEAKDLIRKLLVKDPEKRLTAEEALQHPFF 254

Phosphotransferases. Serine or threonine-specific kinase subfamily. Length = 254

>gnl\|CDD\|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase	Back alignment and domain information

>gnl\|CDD\|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1	Back alignment and domain information

>gnl\|CDD\|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases	Back alignment and domain information

>gnl\|CDD\|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4	Back alignment and domain information

>gnl\|CDD\|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase	Back alignment and domain information

>gnl\|CDD\|215690 pfam00069, Pkinase, Protein kinase domain	Back alignment and domain information

>gnl\|CDD\|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase	Back alignment and domain information

>gnl\|CDD\|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins	Back alignment and domain information

>gnl\|CDD\|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase	Back alignment and domain information

>gnl\|CDD\|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase	Back alignment and domain information

>gnl\|CDD\|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase	Back alignment and domain information

>gnl\|CDD\|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase	Back alignment and domain information

>gnl\|CDD\|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2	Back alignment and domain information

>gnl\|CDD\|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3	Back alignment and domain information

>gnl\|CDD\|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1	Back alignment and domain information

>gnl\|CDD\|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2	Back alignment and domain information

>gnl\|CDD\|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases	Back alignment and domain information

>gnl\|CDD\|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3	Back alignment and domain information

>gnl\|CDD\|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase	Back alignment and domain information

>gnl\|CDD\|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase	Back alignment and domain information

>gnl\|CDD\|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase	Back alignment and domain information

>gnl\|CDD\|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6	Back alignment and domain information

>gnl\|CDD\|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins	Back alignment and domain information

>gnl\|CDD\|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4	Back alignment and domain information

>gnl\|CDD\|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|173729 cd06617, PKc_MKK3_6, Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6	Back alignment and domain information

>gnl\|CDD\|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1	Back alignment and domain information

>gnl\|CDD\|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2	Back alignment and domain information

>gnl\|CDD\|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|132983 cd06652, STKc_MEKK2, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2	Back alignment and domain information

>gnl\|CDD\|132949 cd06618, PKc_MKK7, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7	Back alignment and domain information

>gnl\|CDD\|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase	Back alignment and domain information

>gnl\|CDD\|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1	Back alignment and domain information

>gnl\|CDD\|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase	Back alignment and domain information

>gnl\|CDD\|173623 cd00180, PKc, Catalytic domain of Protein Kinases	Back alignment and domain information

>gnl\|CDD\|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|132984 cd06653, STKc_MEKK3_like_1, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5	Back alignment and domain information

>gnl\|CDD\|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases	Back alignment and domain information

>gnl\|CDD\|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains	Back alignment and domain information

>gnl\|CDD\|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1	Back alignment and domain information

>gnl\|CDD\|132953 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases	Back alignment and domain information

>gnl\|CDD\|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N	Back alignment and domain information

>gnl\|CDD\|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1	Back alignment and domain information

>gnl\|CDD\|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4	Back alignment and domain information

>gnl\|CDD\|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2	Back alignment and domain information

>gnl\|CDD\|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta	Back alignment and domain information

>gnl\|CDD\|173763 cd08223, STKc_Nek4, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4	Back alignment and domain information

>gnl\|CDD\|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase	Back alignment and domain information

>gnl\|CDD\|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8	Back alignment and domain information

>gnl\|CDD\|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains	Back alignment and domain information

>gnl\|CDD\|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C	Back alignment and domain information

>gnl\|CDD\|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7	Back alignment and domain information

>gnl\|CDD\|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|132972 cd06641, STKc_MST3, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3	Back alignment and domain information

>gnl\|CDD\|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9	Back alignment and domain information

>gnl\|CDD\|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|132971 cd06640, STKc_MST4, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4	Back alignment and domain information

>gnl\|CDD\|132970 cd06639, STKc_myosinIIIB, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin	Back alignment and domain information

>gnl\|CDD\|132950 cd06619, PKc_MKK5, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5	Back alignment and domain information

>gnl\|CDD\|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase	Back alignment and domain information

>gnl\|CDD\|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta	Back alignment and domain information

>gnl\|CDD\|173699 cd05608, STKc_GRK1, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1	Back alignment and domain information

>gnl\|CDD\|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase	Back alignment and domain information

>gnl\|CDD\|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1	Back alignment and domain information

>gnl\|CDD\|173762 cd08222, STKc_Nek11, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11	Back alignment and domain information

>gnl\|CDD\|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases	Back alignment and domain information

>gnl\|CDD\|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases	Back alignment and domain information

>gnl\|CDD\|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1	Back alignment and domain information

>gnl\|CDD\|133178 cd05046, PTK_CCK4, Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4	Back alignment and domain information

>gnl\|CDD\|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta	Back alignment and domain information

>gnl\|CDD\|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha	Back alignment and domain information

>gnl\|CDD\|132946 cd06615, PKc_MEK, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase	Back alignment and domain information

>gnl\|CDD\|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B	Back alignment and domain information

>gnl\|CDD\|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7	Back alignment and domain information

>gnl\|CDD\|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1	Back alignment and domain information

>gnl\|CDD\|183880 PRK13184, pknD, serine/threonine-protein kinase; Reviewed	Back alignment and domain information

>gnl\|CDD\|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma	Back alignment and domain information

>gnl\|CDD\|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase	Back alignment and domain information

>gnl\|CDD\|173715 cd05626, STKc_LATS2, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2	Back alignment and domain information

>gnl\|CDD\|173718 cd05629, STKc_NDR_like_fungal, Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|173616 PTZ00426, PTZ00426, cAMP-dependent protein kinase catalytic subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta	Back alignment and domain information

>gnl\|CDD\|214801 smart00750, KIND, kinase non-catalytic C-lobe domain	Back alignment and domain information

>gnl\|CDD\|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		429
KOG0584		632	consensus Serine/threonine protein kinase [General	100.0
KOG0605		550	consensus NDR and related serine/threonine kinases	99.81
KOG0033		355	consensus Ca2+/calmodulin-dependent protein kinase	99.8
KOG0598		357	consensus Ribosomal protein S6 kinase and related	99.79
KOG0578		550	consensus p21-activated serine/threonine protein k	99.79
KOG0588		786	consensus Serine/threonine protein kinase [Cell cy	99.79
KOG0615		475	consensus Serine/threonine protein kinase Chk2 and	99.78
KOG0616		355	consensus cAMP-dependent protein kinase catalytic	99.78
KOG0610		459	consensus Putative serine/threonine protein kinase	99.78
KOG0694		694	consensus Serine/threonine protein kinase [Signal	99.78
KOG0575		592	consensus Polo-like serine/threonine protein kinas	99.76
KOG0581		364	consensus Mitogen-activated protein kinase kinase	99.73
KOG0592		604	consensus 3-phosphoinositide-dependent protein kin	99.72
KOG0690		516	consensus Serine/threonine protein kinase [Signal	99.71
KOG0201		467	consensus Serine/threonine protein kinase [Signal	99.71
KOG0599		411	consensus Phosphorylase kinase gamma subunit [Carb	99.7
KOG0583		370	consensus Serine/threonine protein kinase [Signal	99.7
KOG0032		382	consensus Ca2+/calmodulin-dependent protein kinase	99.68
KOG0582		516	consensus Ste20-like serine/threonine protein kina	99.66
KOG0612		1317	consensus Rho-associated, coiled-coil containing p	99.66
KOG0198		313	consensus MEKK and related serine/threonine protei	99.65
smart00750		176	KIND kinase non-catalytic C-lobe domain. It is an	99.64
KOG0579		1187	consensus Ste20-like serine/threonine protein kina	99.64
KOG0604		400	consensus MAP kinase-activated protein kinase 2 [S	99.64
KOG0696		683	consensus Serine/threonine protein kinase [Signal	99.63
KOG0614		732	consensus cGMP-dependent protein kinase [Signal tr	99.63
cd05571		323	STKc_PKB Catalytic domain of the Protein Serine/Th	99.63
PTZ00263		329	protein kinase A catalytic subunit; Provisional	99.63
KOG4717		864	consensus Serine/threonine protein kinase [Signal	99.62
cd05612		291	STKc_PRKX_like Catalytic domain of PRKX-like Prote	99.62
PTZ00426		340	cAMP-dependent protein kinase catalytic subunit; P	99.62
PTZ00284		467	protein kinase; Provisional	99.62
KOG4279		1226	consensus Serine/threonine protein kinase [Signal	99.61
KOG0660		359	consensus Mitogen-activated protein kinase [Signal	99.61
cd05590		320	STKc_nPKC_eta Catalytic domain of the Protein Seri	99.61
cd05585		312	STKc_YPK1_like Catalytic domain of Yeast Protein K	99.61
cd05631		285	STKc_GRK4 Catalytic domain of the Protein Serine/T	99.6
KOG0597		808	consensus Serine-threonine protein kinase FUSED [G	99.6
cd05591		321	STKc_nPKC_epsilon Catalytic domain of the Protein	99.59
cd05616		323	STKc_cPKC_beta Catalytic domain of the Protein Ser	99.59
PTZ00036		440	glycogen synthase kinase; Provisional	99.59
cd05620		316	STKc_nPKC_delta Catalytic domain of the Protein Se	99.59
cd05599		364	STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel	99.59
cd05600		333	STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p-	99.59
cd05575		323	STKc_SGK Catalytic domain of the Protein Serine/Th	99.59
cd05570		318	STKc_PKC Catalytic domain of the Protein Serine/Th	99.59
KOG0607		463	consensus MAP kinase-interacting kinase and relate	99.59
cd05601		330	STKc_CRIK Catalytic domain of the Protein Serine/T	99.59
cd05589		324	STKc_PKN Catalytic domain of the Protein Serine/Th	99.58
KOG0591		375	consensus NIMA (never in mitosis)-related G2-speci	99.58
cd05587		324	STKc_cPKC Catalytic domain of the Protein Serine/T	99.58
cd07848		287	STKc_CDKL5 Catalytic domain of the Serine/Threonin	99.58
cd05628		363	STKc_NDR1 Catalytic domain of the Protein Serine/T	99.58
cd05593		328	STKc_PKB_gamma Catalytic domain of the Protein Ser	99.58
cd05619		316	STKc_nPKC_theta Catalytic domain of the Protein Se	99.58
cd05625		382	STKc_LATS1 Catalytic domain of the Protein Serine/	99.58
cd07862		290	STKc_CDK6 Catalytic domain of the Serine/Threonine	99.57
cd05573		350	STKc_ROCK_NDR_like Catalytic domain of ROCK- and N	99.57
KOG0596		677	consensus Dual specificity; serine/threonine and t	99.57
cd05596		370	STKc_ROCK Catalytic domain of the Protein Serine/T	99.57
KOG0986		591	consensus G protein-coupled receptor kinase [Signa	99.57
cd05626		381	STKc_LATS2 Catalytic domain of the Protein Serine/	99.57
cd05584		323	STKc_p70S6K Catalytic domain of the Protein Serine	99.57
cd05574		316	STKc_phototropin_like Catalytic domain of Phototro	99.57
cd05592		316	STKc_nPKC_theta_delta Catalytic domain of the Prot	99.57
cd06649		331	PKc_MEK2 Catalytic domain of the dual-specificity	99.57
cd05595		323	STKc_PKB_beta Catalytic domain of the Protein Seri	99.57
cd05594		325	STKc_PKB_alpha Catalytic domain of the Protein Ser	99.56
cd05627		360	STKc_NDR2 Catalytic domain of the Protein Serine/T	99.56
KOG0574		502	consensus STE20-like serine/threonine kinase MST [	99.56
cd05629		377	STKc_NDR_like_fungal Catalytic domain of Fungal Nu	99.56
cd07869		303	STKc_PFTAIRE1 Catalytic domain of the Serine/Threo	99.55
cd05614		332	STKc_MSK2_N N-terminal catalytic domain of the Pro	99.55
KOG0577		948	consensus Serine/threonine protein kinase [Signal	99.55
cd05608		280	STKc_GRK1 Catalytic domain of the Protein Serine/T	99.55
cd06637		272	STKc_TNIK Catalytic domain of the Protein Serine/T	99.55
KOG0983		391	consensus Mitogen-activated protein kinase (MAPK)	99.55
cd06636		282	STKc_MAP4K4_6 Catalytic domain of the Protein Seri	99.55
cd07859		338	STKc_TDY_MAPK_plant Catalytic domain of the Serine	99.55
cd05588		329	STKc_aPKC Catalytic domain of the Protein Serine/T	99.55
cd07875		364	STKc_JNK1 Catalytic domain of the Serine/Threonine	99.54
cd07876		359	STKc_JNK2 Catalytic domain of the Serine/Threonine	99.54
cd07863		288	STKc_CDK4 Catalytic domain of the Serine/Threonine	99.54
cd07871		288	STKc_PCTAIRE3 Catalytic domain of the Serine/Threo	99.54
cd07868		317	STKc_CDK8 Catalytic domain of the Serine/Threonine	99.54
cd05610		669	STKc_MASTL Catalytic domain of the Protein Serine/	99.54
cd05615		323	STKc_cPKC_alpha Catalytic domain of the Protein Se	99.54
cd05586		330	STKc_Sck1_like Catalytic domain of Suppressor of l	99.54
PHA02988		283	hypothetical protein; Provisional	99.54
KOG4721		904	consensus Serine/threonine protein kinase, contain	99.53
KOG0593		396	consensus Predicted protein kinase KKIAMRE [Genera	99.53
cd05598		376	STKc_LATS Catalytic domain of the Protein Serine/T	99.53
cd06625		263	STKc_MEKK3_like Catalytic domain of MAP/ERK kinase	99.53
cd06616		288	PKc_MKK4 Catalytic domain of the dual-specificity	99.53
cd05604		325	STKc_SGK3 Catalytic domain of the Protein Serine/T	99.53
cd08223		257	STKc_Nek4 Catalytic domain of the Protein Serine/T	99.53
cd05618		329	STKc_aPKC_iota Catalytic domain of the Protein Ser	99.52
cd05617		327	STKc_aPKC_zeta Catalytic domain of the Protein Ser	99.52
KOG0585		576	consensus Ca2+/calmodulin-dependent protein kinase	99.52
cd06609		274	STKc_MST3_like Catalytic domain of Mammalian Ste20	99.52
cd07878		343	STKc_p38beta_MAPK11 Catalytic domain of the Serine	99.52
cd05602		325	STKc_SGK1 Catalytic domain of the Protein Serine/T	99.52
cd07874		355	STKc_JNK3 Catalytic domain of the Serine/Threonine	99.51
cd06608		275	STKc_myosinIII_like Catalytic domain of Class III	99.51
cd05621		370	STKc_ROCK2 Catalytic domain of the Protein Serine/	99.51
KOG0661		538	consensus MAPK related serine/threonine protein ki	99.51
cd06631		265	STKc_YSK4 Catalytic domain of the Protein Serine/T	99.51
cd05605		285	STKc_GRK4_like Catalytic domain of G protein-coupl	99.51
cd06655		296	STKc_PAK2 Catalytic domain of the Protein Serine/T	99.51
cd05572		262	STKc_cGK_PKG Catalytic domain of the Protein Serin	99.51
KOG0603		612	consensus Ribosomal protein S6 kinase [Signal tran	99.51
KOG4645		1509	consensus MAPKKK (MAP kinase kinase kinase) SSK2 a	99.51
KOG0663		419	consensus Protein kinase PITSLRE and related kinas	99.51
cd05582		318	STKc_RSK_N N-terminal catalytic domain of the Prot	99.51
cd05623		332	STKc_MRCK_alpha Catalytic domain of the Protein Se	99.5
cd06643		282	STKc_SLK Catalytic domain of the Protein Serine/Th	99.5
KOG0192		362	consensus Tyrosine kinase specific for activated (	99.5
cd05603		321	STKc_SGK2 Catalytic domain of the Protein Serine/T	99.5
PTZ00283		496	serine/threonine protein kinase; Provisional	99.5
KOG0659		318	consensus Cdk activating kinase (CAK)/RNA polymera	99.5
PLN00034		353	mitogen-activated protein kinase kinase; Provision	99.5
cd08529		256	STKc_FA2-like Catalytic domain of the Protein Seri	99.5
cd05607		277	STKc_GRK7 Catalytic domain of the Protein Serine/T	99.5
cd06610		267	STKc_OSR1_SPAK Catalytic domain of the Protein Ser	99.5
cd06651		266	STKc_MEKK3 Catalytic domain of the Protein Serine/	99.5
cd06605		265	PKc_MAPKK Catalytic domain of the dual-specificity	99.49
cd06639		291	STKc_myosinIIIB Catalytic domain of the Protein Se	99.49
cd05622		371	STKc_ROCK1 Catalytic domain of the Protein Serine/	99.49
cd08227		327	PK_STRAD_alpha Pseudokinase domain of STE20-relate	99.49
cd06644		292	STKc_STK10_LOK Catalytic domain of the Protein Ser	99.49
cd06654		296	STKc_PAK1 Catalytic domain of the Protein Serine/T	99.49
KOG0580		281	consensus Serine/threonine protein kinase [Cell cy	99.49
KOG0589		426	consensus Serine/threonine protein kinase [General	99.49
cd07872		309	STKc_PCTAIRE2 Catalytic domain of the Serine/Threo	99.49
cd06612		256	STKc_MST1_2 Catalytic domain of the Protein Serine	99.49
cd07839		284	STKc_CDK5 Catalytic domain of the Serine/Threonine	99.49
cd06650		333	PKc_MEK1 Catalytic domain of the dual-specificity	99.48
cd06624		268	STKc_ASK Catalytic domain of the Protein Serine/Th	99.48
cd06617		283	PKc_MKK3_6 Catalytic domain of the dual-specificit	99.48
cd06619		279	PKc_MKK5 Catalytic domain of the dual-specificity	99.48
cd07853		372	STKc_NLK Catalytic domain of the Serine/Threonine	99.48
cd07867		317	STKc_CDC2L6 Catalytic domain of Serine/Threonine K	99.48
cd05611		260	STKc_Rim15_like Catalytic domain of fungal Rim15-l	99.48
cd05633		279	STKc_GRK3 Catalytic domain of the Protein Serine/T	99.48
cd08218		256	STKc_Nek1 Catalytic domain of the Protein Serine/T	99.48
cd05606		278	STKc_beta_ARK Catalytic domain of the Protein Seri	99.48
cd05630		285	STKc_GRK6 Catalytic domain of the Protein Serine/T	99.47
cd06611		280	STKc_SLK_like Catalytic domain of Ste20-like kinas	99.47
cd08217		265	STKc_Nek2 Catalytic domain of the Protein Serine/T	99.47
PHA03212		391	serine/threonine kinase US3; Provisional	99.47
cd07860		284	STKc_CDK2_3 Catalytic domain of the Serine/Threoni	99.47
PTZ00267		478	NIMA-related protein kinase; Provisional	99.47
cd07845		309	STKc_CDK10 Catalytic domain of the Serine/Threonin	99.47
cd06638		286	STKc_myosinIIIA Catalytic domain of the Protein Se	99.47
cd06607		307	STKc_TAO Catalytic domain of the Protein Serine/Th	99.46
cd08220		256	STKc_Nek8 Catalytic domain of the Protein Serine/T	99.46
cd06648		285	STKc_PAK_II Catalytic domain of the Protein Serine	99.46
cd06645		267	STKc_MAP4K3 Catalytic domain of the Protein Serine	99.46
cd06628		267	STKc_MAPKKK_Byr2_like Catalytic domain of fungal B	99.46
cd07831		282	STKc_MOK Catalytic domain of the Serine/Threonine	99.46
cd06652		265	STKc_MEKK2 Catalytic domain of the Protein Serine/	99.46
cd07861		285	STKc_CDK1_euk Catalytic domain of the Serine/Threo	99.46
PHA03207		392	serine/threonine kinase US3; Provisional	99.46
KOG0695		593	consensus Serine/threonine protein kinase [Signal	99.46
cd08225		257	STKc_Nek5 Catalytic domain of the Protein Serine/T	99.45
cd06658		292	STKc_PAK5 Catalytic domain of the Protein Serine/T	99.45
cd05597		331	STKc_DMPK_like Catalytic domain of Myotonic Dystro	99.45
cd05579		265	STKc_MAST_like Catalytic domain of Microtubule-ass	99.45
KOG0608		1034	consensus Warts/lats-like serine threonine kinases	99.45
cd07873		301	STKc_PCTAIRE1 Catalytic domain of the Serine/Threo	99.45
cd05580		290	STKc_PKA Catalytic domain of the Protein Serine/Th	99.45
cd06647		293	STKc_PAK_I Catalytic domain of the Protein Serine/	99.45
cd06633		313	STKc_TAO3 Catalytic domain of the Protein Serine/T	99.45
cd06917		277	STKc_NAK1_like Catalytic domain of Fungal Nak1-lik	99.45
cd05624		331	STKc_MRCK_beta Catalytic domain of the Protein Ser	99.44
KOG0667		586	consensus Dual-specificity tyrosine-phosphorylatio	99.44
cd05609		305	STKc_MAST Catalytic domain of the Protein Serine/T	99.44
PHA03390		267	pk1 serine/threonine-protein kinase 1; Provisional	99.44
cd06606		260	STKc_MAPKKK Catalytic domain of the Protein Serine	99.44
cd06623		264	PKc_MAPKK_plant_like Catalytic domain of Plant dua	99.44
cd06618		296	PKc_MKK7 Catalytic domain of the dual-specificity	99.44
cd06656		297	STKc_PAK3 Catalytic domain of the Protein Serine/T	99.44
PHA03209		357	serine/threonine kinase US3; Provisional	99.44
cd05632		285	STKc_GRK5 Catalytic domain of the Protein Serine/T	99.43
cd06614		286	STKc_PAK Catalytic domain of the Protein Serine/Th	99.43
cd06634		308	STKc_TAO2 Catalytic domain of the Protein Serine/T	99.43
cd07837		295	STKc_CdkB_plant Catalytic domain of the Serine/Thr	99.43
cd07866		311	STKc_BUR1 Catalytic domain of the Serine/Threonine	99.42
PTZ00266		1021	NIMA-related protein kinase; Provisional	99.42
cd06620		284	PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr	99.42
cd07832		286	STKc_CCRK Catalytic domain of the Serine/Threonine	99.42
cd06630		268	STKc_MEKK1 Catalytic domain of the Protein Serine/	99.42
cd06622		286	PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS	99.42
cd08215		258	STKc_Nek Catalytic domain of the Protein Serine/Th	99.42
cd06632		258	STKc_MEKK1_plant Catalytic domain of the Protein S	99.42
cd08221		256	STKc_Nek9 Catalytic domain of the Protein Serine/T	99.42
KOG0595		429	consensus Serine/threonine-protein kinase involved	99.42
cd07879		342	STKc_p38delta_MAPK13 Catalytic domain of the Serin	99.42
cd07835		283	STKc_CDK1_like Catalytic domain of Cyclin-Dependen	99.42
cd06659		297	STKc_PAK6 Catalytic domain of the Protein Serine/T	99.42
cd06640		277	STKc_MST4 Catalytic domain of the Protein Serine/T	99.42
cd07854		342	STKc_MAPK4_6 Catalytic domain of the Serine/Threon	99.41
cd08216		314	PK_STRAD Pseudokinase domain of STE20-related kina	99.41
cd08222		260	STKc_Nek11 Catalytic domain of the Protein Serine/	99.41
cd06615		308	PKc_MEK Catalytic domain of the dual-specificity P	99.41
KOG0600		560	consensus Cdc2-related protein kinase [Cell cycle	99.41
cd06653		264	STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina	99.41
cd07850		353	STKc_JNK Catalytic domain of the Serine/Threonine	99.41
cd07865		310	STKc_CDK9 Catalytic domain of the Serine/Threonine	99.41
cd06626		264	STKc_MEKK4 Catalytic domain of the Protein Serine/	99.41
cd07834		330	STKc_MAPK Catalytic domain of the Serine/Threonine	99.41
cd06635		317	STKc_TAO1 Catalytic domain of the Protein Serine/T	99.41
cd06613		262	STKc_MAP4K3_like Catalytic domain of Mitogen-activ	99.41
cd05122		253	PKc_STE Catalytic domain of STE family Protein Kin	99.4
PF00069		260	Pkinase: Protein kinase domain Protein kinase; unc	99.4
cd07833		288	STKc_CDKL Catalytic domain of Cyclin-Dependent pro	99.4
cd06642		277	STKc_STK25-YSK1 Catalytic domain of the Protein Se	99.4
PHA03211		461	serine/threonine kinase US3; Provisional	99.39
cd07851		343	STKc_p38 Catalytic domain of the Serine/Threonine	99.39
PLN00009		294	cyclin-dependent kinase A; Provisional	99.39
cd07847		286	STKc_CDKL1_4 Catalytic domain of the Serine/Threon	99.39
cd06629		272	STKc_MAPKKK_Bck1_like Catalytic domain of fungal B	99.39
cd07855		334	STKc_ERK5 Catalytic domain of the Serine/Threonine	99.39
cd07849		336	STKc_ERK1_2_like Catalytic domain of Extracellular	99.38
cd05581		280	STKc_PDK1 Catalytic domain of the Protein Serine/T	99.38
PTZ00024		335	cyclin-dependent protein kinase; Provisional	99.38
cd05123		250	STKc_AGC Catalytic domain of AGC family Protein Se	99.38
KOG0658		364	consensus Glycogen synthase kinase-3 [Carbohydrate	99.38
cd06646		267	STKc_MAP4K5 Catalytic domain of the Protein Serine	99.38
cd05577		277	STKc_GRK Catalytic domain of the Protein Serine/Th	99.38
cd07838		287	STKc_CDK4_6_like Catalytic domain of Cyclin-Depend	99.38
cd05048		283	PTKc_Ror Catalytic Domain of the Protein Tyrosine	99.38
cd07843		293	STKc_CDC2L1 Catalytic domain of the Serine/Threoni	99.37
cd06621		287	PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek	99.37
cd08226		328	PK_STRAD_beta Pseudokinase domain of STE20-related	99.37
cd06641		277	STKc_MST3 Catalytic domain of the Protein Serine/T	99.37
cd07846		286	STKc_CDKL2_3 Catalytic domain of the Serine/Threon	99.37
cd05118		283	STKc_CMGC Catalytic domain of CMGC family Serine/T	99.37
cd06657		292	STKc_PAK4 Catalytic domain of the Protein Serine/T	99.37
cd08530		256	STKc_CNK2-like Catalytic domain of the Protein Ser	99.36
cd07836		284	STKc_Pho85 Catalytic domain of the Serine/Threonin	99.36
cd07870		291	STKc_PFTAIRE2 Catalytic domain of the Serine/Threo	99.36
cd07858		337	STKc_TEY_MAPK_plant Catalytic domain of the Serine	99.36
KOG0671		415	consensus LAMMER dual specificity kinases [Signal	99.35
cd05049		280	PTKc_Trk Catalytic domain of the Protein Tyrosine	99.35
cd07842		316	STKc_CDK8_like Catalytic domain of Cyclin-Dependen	99.35
cd05102		338	PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi	99.34
cd07841		298	STKc_CDK7 Catalytic domain of the Serine/Threonine	99.34
cd07852		337	STKc_MAPK15 Catalytic domain of the Serine/Threoni	99.34
cd05578		258	STKc_Yank1 Catalytic domain of the Protein Serine/	99.34
cd07830		283	STKc_MAK_like Catalytic domain of Male germ cell-A	99.34
smart00220		244	S_TKc Serine/Threonine protein kinases, catalytic	99.33
cd06627		254	STKc_Cdc7_like Catalytic domain of Cell division c	99.33
cd08219		255	STKc_Nek3 Catalytic domain of the Protein Serine/T	99.33
PLN00181		793	protein SPA1-RELATED; Provisional	99.33
cd07857		332	STKc_MPK1 Catalytic domain of the Serine/Threonine	99.33
cd07877		345	STKc_p38alpha_MAPK14 Catalytic domain of the Serin	99.32
cd07844		291	STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like	99.32
cd05583		288	STKc_MSK_N N-terminal catalytic domain of the Prot	99.32
KOG0665		369	consensus Jun-N-terminal kinase (JNK) [Signal tran	99.32
cd05613		290	STKc_MSK1_N N-terminal catalytic domain of the Pro	99.32
cd07840		287	STKc_CDK9_like Catalytic domain of Cyclin-Dependen	99.32
cd05576		237	STKc_RPK118_like Catalytic domain of the Protein S	99.31
cd07880		343	STKc_p38gamma_MAPK12 Catalytic domain of the Serin	99.31
cd05061		288	PTKc_InsR Catalytic domain of the Protein Tyrosine	99.3
PHA03210		501	serine/threonine kinase US3; Provisional	99.3
cd07829		282	STKc_CDK_like Catalytic domain of Cyclin-Dependent	99.29
cd05093		288	PTKc_TrkB Catalytic domain of the Protein Tyrosine	99.29
KOG0197		468	consensus Tyrosine kinases [Signal transduction me	99.29
KOG0594		323	consensus Protein kinase PCTAIRE and related kinas	99.29
KOG0587		953	consensus Traf2- and Nck-interacting kinase and re	99.28
cd05094		291	PTKc_TrkC Catalytic domain of the Protein Tyrosine	99.28
cd07864		302	STKc_CDK12 Catalytic domain of the Serine/Threonin	99.28
cd00192		262	PTKc Catalytic domain of Protein Tyrosine Kinases.	99.28
cd05062		277	PTKc_IGF-1R Catalytic domain of the Protein Tyrosi	99.28
cd05054		337	PTKc_VEGFR Catalytic domain of the Protein Tyrosin	99.28
cd05091		283	PTKc_Ror2 Catalytic domain of the Protein Tyrosine	99.28
cd08228		267	STKc_Nek6 Catalytic domain of the Protein Serine/T	99.28
cd05116		257	PTKc_Syk Catalytic domain of the Protein Tyrosine	99.28
cd07856		328	STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre	99.28
PLN03225		566	Serine/threonine-protein kinase SNT7; Provisional	99.27
cd05036		277	PTKc_ALK_LTK Catalytic domain of the Protein Tyros	99.27
cd08229		267	STKc_Nek7 Catalytic domain of the Protein Serine/T	99.26
cd05114		256	PTKc_Tec_Rlk Catalytic domain of the Protein Tyros	99.26
KOG4236		888	consensus Serine/threonine protein kinase PKC mu/P	99.26
cd05106		374	PTKc_CSF-1R Catalytic domain of the Protein Tyrosi	99.26
cd05052		263	PTKc_Abl Catalytic domain of the Protein Tyrosine	99.26
cd05035		273	PTKc_Axl_like Catalytic Domain of Axl-like Protein	99.24
cd08224		267	STKc_Nek6_Nek7 Catalytic domain of the Protein Ser	99.24
cd05032		277	PTKc_InsR_like Catalytic domain of Insulin Recepto	99.24
cd05092		280	PTKc_TrkA Catalytic domain of the Protein Tyrosine	99.24
cd05072		261	PTKc_Lyn Catalytic domain of the Protein Tyrosine	99.24
cd05064		266	PTKc_EphR_A10 Catalytic domain of the Protein Tyro	99.24
cd08528		269	STKc_Nek10 Catalytic domain of the Protein Serine/	99.23
cd05090		283	PTKc_Ror1 Catalytic domain of the Protein Tyrosine	99.23
cd05058		262	PTKc_Met_Ron Catalytic domain of the Protein Tyros	99.23
cd05044		269	PTKc_c-ros Catalytic domain of the Protein Tyrosin	99.23
cd05060		257	PTKc_Syk_like Catalytic domain of Spleen Tyrosine	99.23
KOG0666		438	consensus Cyclin C-dependent kinase CDK8 [Transcri	99.23
cd05040		257	PTKc_Ack_like Catalytic domain of the Protein Tyro	99.23
cd05055		302	PTKc_PDGFR Catalytic domain of the Protein Tyrosin	99.23
cd05053		293	PTKc_FGFR Catalytic domain of the Protein Tyrosine	99.22
cd05089		297	PTKc_Tie1 Catalytic domain of the Protein Tyrosine	99.21
cd05075		272	PTKc_Axl Catalytic domain of the Protein Tyrosine	99.21
cd05087		269	PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein	99.21
KOG0606		1205	consensus Microtubule-associated serine/threonine	99.21
cd05067		260	PTKc_Lck_Blk Catalytic domain of the Protein Tyros	99.2
cd05104		375	PTKc_Kit Catalytic domain of the Protein Tyrosine	99.2
cd05111		279	PTK_HER3 Pseudokinase domain of the Protein Tyrosi	99.2
cd05070		260	PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros	99.2
PHA02882		294	putative serine/threonine kinase; Provisional	99.2
PF07714		259	Pkinase_Tyr: Protein tyrosine kinase Protein kinas	99.2
cd05113		256	PTKc_Btk_Bmx Catalytic domain of the Protein Tyros	99.2
cd05082		256	PTKc_Csk Catalytic domain of the Protein Tyrosine	99.19
cd05115		257	PTKc_Zap-70 Catalytic domain of the Protein Tyrosi	99.19
cd05112		256	PTKc_Itk Catalytic domain of the Protein Tyrosine	99.19
cd05059		256	PTKc_Tec_like Catalytic domain of Tec-like Protein	99.19
KOG0670		752	consensus U4/U6-associated splicing factor PRP4 [R	99.19
KOG1026		774	consensus Nerve growth factor receptor TRKA and re	99.19
cd05078		258	PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain	99.19
cd05043		280	PTK_Ryk Pseudokinase domain of Ryk (Receptor relat	99.18
cd05148		261	PTKc_Srm_Brk Catalytic domain of the Protein Tyros	99.18
cd05069		260	PTKc_Yes Catalytic domain of the Protein Tyrosine	99.18
cd05050		288	PTKc_Musk Catalytic domain of the Protein Tyrosine	99.18
cd05051		296	PTKc_DDR Catalytic domain of the Protein Tyrosine	99.18
cd05041		251	PTKc_Fes_like Catalytic domain of Fes-like Protein	99.18
cd05108		316	PTKc_EGFR Catalytic domain of the Protein Tyrosine	99.18
cd05088		303	PTKc_Tie2 Catalytic domain of the Protein Tyrosine	99.18
smart00219		258	TyrKc Tyrosine kinase, catalytic domain. Phosphotr	99.18
cd05098		307	PTKc_FGFR1 Catalytic domain of the Protein Tyrosin	99.18
KOG1006		361	consensus Mitogen-activated protein kinase (MAPK)	99.17
KOG0193		678	consensus Serine/threonine protein kinase RAF [Sig	99.17
cd05085		250	PTKc_Fer Catalytic domain of the Protein Tyrosine	99.17
KOG0611		668	consensus Predicted serine/threonine protein kinas	99.17
cd05033		266	PTKc_EphR Catalytic domain of Ephrin Receptor Prot	99.17
cd05099		314	PTKc_FGFR4 Catalytic domain of the Protein Tyrosin	99.16
cd05068		261	PTKc_Frk_like Catalytic domain of Fyn-related kina	99.16
cd05077		262	PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th	99.16
cd05046		275	PTK_CCK4 Pseudokinase domain of the Protein Tyrosi	99.16
KOG0586		596	consensus Serine/threonine protein kinase [General	99.16
cd05109		279	PTKc_HER2 Catalytic domain of the Protein Tyrosine	99.16
cd05063		268	PTKc_EphR_A2 Catalytic domain of the Protein Tyros	99.16
cd05056		270	PTKc_FAK Catalytic domain of the Protein Tyrosine	99.16
cd05084		252	PTKc_Fes Catalytic domain of the Protein Tyrosine	99.15
cd05071		262	PTKc_Src Catalytic domain of the Protein Tyrosine	99.15
cd05047		270	PTKc_Tie Catalytic domain of Tie Protein Tyrosine	99.15
cd05045		290	PTKc_RET Catalytic domain of the Protein Tyrosine	99.15
cd05101		304	PTKc_FGFR2 Catalytic domain of the Protein Tyrosin	99.14
KOG1290		590	consensus Serine/threonine protein kinase [Signal	99.14
cd05086		268	PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi	99.13
cd05096		304	PTKc_DDR1 Catalytic domain of the Protein Tyrosine	99.13
KOG1035		1351	consensus eIF-2alpha kinase GCN2 [Translation, rib	99.12
cd05073		260	PTKc_Hck Catalytic domain of the Protein Tyrosine	99.12
cd05039		256	PTKc_Csk_like Catalytic domain of C-terminal Src k	99.12
cd05100		334	PTKc_FGFR3 Catalytic domain of the Protein Tyrosin	99.12
cd05042		269	PTKc_Aatyk Catalytic domain of the Protein Tyrosin	99.11
cd05034		261	PTKc_Src_like Catalytic domain of Src kinase-like	99.11
cd05083		254	PTKc_Chk Catalytic domain of the Protein Tyrosine	99.1
cd05105		400	PTKc_PDGFR_alpha Catalytic domain of the Protein T	99.1
cd05107		401	PTKc_PDGFR_beta Catalytic domain of the Protein Ty	99.1
cd05097		295	PTKc_DDR_like Catalytic domain of Discoidin Domain	99.09
cd05076		274	PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th	99.08
cd05066		267	PTKc_EphR_A Catalytic domain of the Protein Tyrosi	99.08
KOG2345		302	consensus Serine/threonine protein kinase/TGF-beta	99.08
cd05103		343	PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi	99.07
cd05065		269	PTKc_EphR_B Catalytic domain of the Protein Tyrosi	99.07
cd05110		303	PTKc_HER4 Catalytic domain of the Protein Tyrosine	99.07
cd05057		279	PTKc_EGFR_like Catalytic domain of Epidermal Growt	99.07
KOG1095		1025	consensus Protein tyrosine kinase [Signal transduc	99.07
cd05074		273	PTKc_Tyro3 Catalytic domain of the Protein Tyrosin	99.06
cd05037		259	PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the	99.06
cd05080		283	PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the	99.05
PLN03224		507	probable serine/threonine protein kinase; Provisio	99.05
cd05095		296	PTKc_DDR2 Catalytic domain of the Protein Tyrosine	99.05
KOG1989		738	consensus ARK protein kinase family [Signal transd	99.04
KOG1151		775	consensus Tousled-like protein kinase [Signal tran	99.02
PRK13184		932	pknD serine/threonine-protein kinase; Reviewed	99.01
KOG1167		418	consensus Serine/threonine protein kinase of the C	99.0
KOG1027		903	consensus Serine/threonine protein kinase and endo	99.0
KOG0669		376	consensus Cyclin T-dependent kinase CDK9 [Cell cyc	99.0
KOG0200		609	consensus Fibroblast/platelet-derived growth facto	98.98
cd05079		284	PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the	98.98
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	98.95
KOG1024		563	consensus Receptor-like protein tyrosine kinase RY	98.94
KOG0199		1039	consensus ACK and related non-receptor tyrosine ki	98.94
KOG0662		292	consensus Cyclin-dependent kinase CDK5 [Intracellu	98.92
KOG0576		829	consensus Mitogen-activated protein kinase kinase	98.92
cd05038		284	PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P	98.9
KOG0194		474	consensus Protein tyrosine kinase [Signal transduc	98.9
cd05081		284	PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of	98.88
KOG0668		338	consensus Casein kinase II, alpha subunit [Signal	98.83
KOG0603		612	consensus Ribosomal protein S6 kinase [Signal tran	98.81
KOG4257		974	consensus Focal adhesion tyrosine kinase FAK, cont	98.73
KOG4278		1157	consensus Protein tyrosine kinase [Signal transduc	98.72
KOG0664		449	consensus Nemo-like MAPK-related serine/threonine	98.67
KOG0196		996	consensus Tyrosine kinase, EPH (ephrin) receptor f	98.64
KOG0590		601	consensus Checkpoint kinase and related serine/thr	98.6
KOG0606		1205	consensus Microtubule-associated serine/threonine	98.51
KOG1033		516	consensus eIF-2alpha kinase PEK/EIF2AK3 [Translati	98.51
KOG1187		361	consensus Serine/threonine protein kinase [Signal	98.5
KOG4250		732	consensus TANK binding protein kinase TBK1 [Signal	98.45
KOG0195		448	consensus Integrin-linked kinase [Signal transduct	98.43
KOG2052		513	consensus Activin A type IB receptor, serine/threo	98.42
KOG0984		282	consensus Mitogen-activated protein kinase (MAPK)	98.39
KOG1025		1177	consensus Epidermal growth factor receptor EGFR an	98.35
KOG1094		807	consensus Discoidin domain receptor DDR1 [Signal t	98.3
KOG3653		534	consensus Transforming growth factor beta/activin	98.21
cd00180		215	PKc Catalytic domain of Protein Kinases. Protein K	98.19
COG0515		384	SPS1 Serine/threonine protein kinase [General func	98.0
smart00221		225	STYKc Protein kinase; unclassified specificity. Ph	97.89
KOG1023		484	consensus Natriuretic peptide receptor, guanylate	97.75
KOG0590		601	consensus Checkpoint kinase and related serine/thr	97.49
KOG1240		1431	consensus Protein kinase containing WD40 repeats [	97.4
KOG1345		378	consensus Serine/threonine kinase [Signal transduc	97.37
KOG4158		598	consensus BRPK/PTEN-induced protein kinase [Signal	97.16
PF14531		288	Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_	97.08
KOG1266		458	consensus Protein kinase [Signal transduction mech	96.22
PF12202		38	OSR1_C: Oxidative-stress-responsive kinase 1 C ter	95.9
KOG0601		524	consensus Cyclin-dependent kinase WEE1 [Cell cycle	93.81
KOG2137		700	consensus Protein kinase [Signal transduction mech	93.53
COG4248		637	Uncharacterized protein with protein kinase and he	89.2
KOG1164		322	consensus Casein kinase (serine/threonine/tyrosine	88.8
KOG0584		632	consensus Serine/threonine protein kinase [General	86.68

>KOG0584 consensus Serine/threonine protein kinase [General function prediction only]	Back alignment and domain information

Probab=100.00  E-value=1.8e-37  Score=324.97  Aligned_cols=378  Identities=39%  Similarity=0.512  Sum_probs=248.7

Q ss_pred             cccccCCCCccCccccccCCCccccchhhhHHHHHHhhcCCCCCCCCCHHHHHHHHHcCCCCCCCcccccHHHHHHHHHH
Q 014176            6 LVRTLGTPEFMAPELYEEDYNELVDIYSFGMCVLEMLTSEYPYSECSNPAQIYKKVTSGKLPGAFHRIQDAEARRFVGKC   85 (429)
Q Consensus         6 l~t~vGTp~YmAPEvl~~~ys~kvDVWSlGviLyELltG~~Pf~~~~~~~~i~~~I~~g~~p~~~~~~~s~eakdLI~kc   85 (429)
                      .++++|||.|||||++.+.|++.+||||||||++||+|+.+||..|.++++||+++..|..|..+.+.-++++++||.+|
T Consensus       201 aksvIGTPEFMAPEmYEE~YnE~VDVYaFGMCmLEMvT~eYPYsEC~n~AQIYKKV~SGiKP~sl~kV~dPevr~fIekC  280 (632)
T KOG0584|consen  201 AKSVIGTPEFMAPEMYEENYNELVDVYAFGMCMLEMVTSEYPYSECTNPAQIYKKVTSGIKPAALSKVKDPEVREFIEKC  280 (632)
T ss_pred             cceeccCccccChHHHhhhcchhhhhhhhhHHHHHHHhccCChhhhCCHHHHHHHHHcCCCHHHhhccCCHHHHHHHHHH
Confidence            35689999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhCcCCCCCHHHHhcCcccccCCCCC---------CCCCC--C----CCcC---CCCCCcchhhccC-----------cc
Q 014176           86 LENVSKRLPAKELLLDPFLASDAGEP---------LLIPQ--V----PSFQ---NLNPNGAVMELVP-----------KF  136 (429)
Q Consensus        86 L~dP~kRpSa~ElL~Hpff~~~~~~~---------~~~p~--~----P~~~---~~~~~~~~~~~~~-----------~~  136 (429)
                      |.....|+++.|||+||||+......         .+...  .    +...   ..+..+-.++...           .+
T Consensus       281 l~~~~~R~sa~eLL~d~Ff~~d~g~~~~~~e~d~~~~~~~~~~~~~~~~~~~~~~~n~i~~~~~~~~D~~e~v~~em~~~  360 (632)
T KOG0584|consen  281 LATKSERLSAKELLKDPFFDEDGGIVELAPEDDMSDPALSLSLRDEDGKKNKRPKANAIQFDYNLNTDESEEVAQEMVEE  360 (632)
T ss_pred             hcCchhccCHHHHhhChhhccccccccccchhhcccccccccccccchhhcCCcccccccceeecCCCchhHHHHHHHHh
Confidence            99999999999999999999874310         00000  0    0000   0000000000000           00


Q ss_pred             c-cc-------ccccccccccccCCCCCcccceeeeeeecccccccccccCcccCCCCCHHHHHHHHHHhcCCCCCCHHH
Q 014176          137 A-VD-------SDRRKSTDMTITGTMNPEDDTIFLKVQITDKDGQARNIYFPFDIFNDTATEVALEMVKELEITDWEPLE  208 (429)
Q Consensus       137 ~-~~-------~~~~k~~~~~i~g~ln~ed~~i~L~lri~d~~g~~r~I~f~fd~~~Dta~sVa~EMVeel~i~~~D~~~  208 (429)
                      . ..       .+..+...+.|+++.+.+...++|.|+|.+++|..++|+|+|++.+||+.+|+.|||++++++++++..
T Consensus       361 ~~~~edd~~~v~r~~~~~~~~ikgkr~~~~~~~~l~l~i~~~~g~~r~i~fpf~~~~dta~~Va~eMv~el~~~dq~v~~  440 (632)
T KOG0584|consen  361 EIVSEDDSREVARLLKDTVFSIKGKRNDRQTEISLELRIADEDGLVRNIHFPFDLEGDTAPSVAHEMVEELEITDQPVVN  440 (632)
T ss_pred             ccCCcchHHHHHHHhccceeeechhhhcccccceeEeeccCCCCCcccccCCCcCCCcchhHHHHHHHhhcCCcccchhh
Confidence            0 00       112234677889999887779999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhhccCCCcccCCCCCcccccccccccCCCCCCCCCCCCCcccCCCC--CCCCCCccccccCCCC-CCCCCcc
Q 014176          209 IAEMIEQEISSLVPNWKECGSPQFCHQHSFSYEDEDDDNDDDGIYHPFYSNSSH--SSSHASLPAFFTNNAN-SPPSWLQ  285 (429)
Q Consensus       209 IA~~Id~~i~~lip~w~~~~~~~~~~q~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~-~~~~~~~  285 (429)
                      ||+|||..+..|+|.|+...               ..+.. -...|...+.|.+  ++++....+.+..+.+ ....|-+
T Consensus       441 ia~mid~~i~~L~p~~~~~~---------------~~~~s-~~~~~~~~~~s~~~~~~s~~~~~~~~~~~~~~~~~~~~~  504 (632)
T KOG0584|consen  441 IAEMIDGEISALVPNWKAST---------------PNDES-PHEQHTDNSVSIQRSSESATQSQKSFSSADPQQVAPFVQ  504 (632)
T ss_pred             HHHHHhchhhhcCCccCCCC---------------Ccccc-chhccCcccccccCCCccccccccccccccccccccccc
Confidence            99999999999999997632               00010 0012223333331  1112222111211112 3444666


Q ss_pred             cCCCCCCCCCCCCCCCCCcccccccccCCCCCCccccccCCCchhhhhccc-c--ccccccccccCCcCCCccccccccc
Q 014176          286 QEDLLGNDDASSNGSVSSFKYSSWDYHSGNEDDSEFSHRAGEPLCIARATQ-K--STRFCPEAAMNNDRCNSEDVNSRKA  362 (429)
Q Consensus       286 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~--~~~~~~~~~~~~~~~~~~~~~~~~~  362 (429)
                      +.   +.|..++.......+.....+....+.+.        .+..+..++ +  +-.|+...... + .....+. -..
T Consensus       505 ~~---~~~~~~~~~~~r~~~~~~~~~~~~~~~~~--------~~~~q~~t~~~~~~~~~~~~~~~~-~-~~~~~~~-~~~  570 (632)
T KOG0584|consen  505 QS---MEDPLSSDVESRFSKNELVQTQVSPLGER--------LVQCQLETHHKQETFEFDQPLSSP-E-EIAKAMS-EQE  570 (632)
T ss_pred             cc---ccCCCccccccccccccccccccccchhh--------hhhhhhccccceeeecccccCCch-h-hhhhhhh-ccc
Confidence            53   44432222112222222222222111111        110111122 1  34444443321 0 0000000 001


Q ss_pred             cCCCCCCCCCccccchhhhhhhHHhhHhHHHHHhhhhcccccccccccccC
Q 014176          363 CRSNSNNHRKLSRIRSLVDVRSQLLHRSLVEEIHKRRLFKTVGAVENIGFH  413 (429)
Q Consensus       363 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  413 (429)
                      +.-.....+-.++.|++++...++||+...+...|+..+|+.....-.|++
T Consensus       571 ~~l~~e~~~~~~q~r~~~q~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~  621 (632)
T KOG0584|consen  571 EQLKTELERIESQLRSLVQDALELLSRAVEEAKDKVIATKQKSVNSAHPAQ  621 (632)
T ss_pred             hhhhHHHHHHHHHhhHHHHHHHHHHHHHHHHHHhhhhhccccccccccCCC
Confidence            111224467788999999999999999999999999999998888888777

>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only]	Back alignment and domain information

>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms]	Back alignment and domain information

>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms]	Back alignment and domain information

>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only]	Back alignment and domain information

>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism]	Back alignment and domain information

>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms]	Back alignment and domain information

>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms]	Back alignment and domain information

>smart00750 KIND kinase non-catalytic C-lobe domain	Back alignment and domain information

>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B	Back alignment and domain information

>PTZ00263 protein kinase A catalytic subunit; Provisional	Back alignment and domain information

>KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases	Back alignment and domain information

>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional	Back alignment and domain information

>PTZ00284 protein kinase; Provisional	Back alignment and domain information

>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta	Back alignment and domain information

>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4	Back alignment and domain information

>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only]	Back alignment and domain information

>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon	Back alignment and domain information

>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta	Back alignment and domain information

>PTZ00036 glycogen synthase kinase; Provisional	Back alignment and domain information

>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta	Back alignment and domain information

>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase	Back alignment and domain information

>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C	Back alignment and domain information

>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms]	Back alignment and domain information

>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase	Back alignment and domain information

>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N	Back alignment and domain information

>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C	Back alignment and domain information

>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5	Back alignment and domain information

>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1	Back alignment and domain information

>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma	Back alignment and domain information

>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta	Back alignment and domain information

>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1	Back alignment and domain information

>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6	Back alignment and domain information

>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase	Back alignment and domain information

>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2	Back alignment and domain information

>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase	Back alignment and domain information

>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta	Back alignment and domain information

>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2	Back alignment and domain information

>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta	Back alignment and domain information

>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha	Back alignment and domain information

>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2	Back alignment and domain information

>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms]	Back alignment and domain information

>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase	Back alignment and domain information

>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2	Back alignment and domain information

>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1	Back alignment and domain information

>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase	Back alignment and domain information

>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms]	Back alignment and domain information

>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6	Back alignment and domain information

>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants	Back alignment and domain information

>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C	Back alignment and domain information

>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1	Back alignment and domain information

>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2	Back alignment and domain information

>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4	Back alignment and domain information

>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase	Back alignment and domain information

>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8	Back alignment and domain information

>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase	Back alignment and domain information

>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha	Back alignment and domain information

>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>PHA02988 hypothetical protein; Provisional	Back alignment and domain information

>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms]	Back alignment and domain information

>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only]	Back alignment and domain information

>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor	Back alignment and domain information

>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4	Back alignment and domain information

>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3	Back alignment and domain information

>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4	Back alignment and domain information

>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota	Back alignment and domain information

>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta	Back alignment and domain information

>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms]	Back alignment and domain information

>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase	Back alignment and domain information

>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1	Back alignment and domain information

>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3	Back alignment and domain information

>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2	Back alignment and domain information

>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4	Back alignment and domain information

>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2	Back alignment and domain information

>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase	Back alignment and domain information

>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms]	Back alignment and domain information

>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only]	Back alignment and domain information

>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase	Back alignment and domain information

>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha	Back alignment and domain information

>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase	Back alignment and domain information

>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms]	Back alignment and domain information

>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2	Back alignment and domain information

>PTZ00283 serine/threonine protein kinase; Provisional	Back alignment and domain information

>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair]	Back alignment and domain information

>PLN00034 mitogen-activated protein kinase kinase; Provisional	Back alignment and domain information

>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains	Back alignment and domain information

>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7	Back alignment and domain information

>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase	Back alignment and domain information

>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3	Back alignment and domain information

>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase	Back alignment and domain information

>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin	Back alignment and domain information

>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1	Back alignment and domain information

>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha	Back alignment and domain information

>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase	Back alignment and domain information

>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1	Back alignment and domain information

>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0589 consensus Serine/threonine protein kinase [General function prediction only]	Back alignment and domain information

>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase	Back alignment and domain information

>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2	Back alignment and domain information

>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5	Back alignment and domain information

>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1	Back alignment and domain information

>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase	Back alignment and domain information

>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6	Back alignment and domain information

>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5	Back alignment and domain information

>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase	Back alignment and domain information

>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6	Back alignment and domain information

>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3	Back alignment and domain information

>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1	Back alignment and domain information

>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase	Back alignment and domain information

>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6	Back alignment and domain information

>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2	Back alignment and domain information

>PHA03212 serine/threonine kinase US3; Provisional	Back alignment and domain information

>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3	Back alignment and domain information

>PTZ00267 NIMA-related protein kinase; Provisional	Back alignment and domain information

>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10	Back alignment and domain information

>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin	Back alignment and domain information

>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins	Back alignment and domain information

>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8	Back alignment and domain information

>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase	Back alignment and domain information

>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3	Back alignment and domain information

>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases	Back alignment and domain information

>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase	Back alignment and domain information

>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2	Back alignment and domain information

>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like	Back alignment and domain information

>PHA03207 serine/threonine kinase US3; Provisional	Back alignment and domain information

>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5	Back alignment and domain information

>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5	Back alignment and domain information

>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins	Back alignment and domain information

>KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase	Back alignment and domain information

>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase	Back alignment and domain information

>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase	Back alignment and domain information

>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3	Back alignment and domain information

>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta	Back alignment and domain information

>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only]	Back alignment and domain information

>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase	Back alignment and domain information

>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional	Back alignment and domain information

>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase	Back alignment and domain information

>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins	Back alignment and domain information

>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7	Back alignment and domain information

>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3	Back alignment and domain information

>PHA03209 serine/threonine kinase US3; Provisional	Back alignment and domain information

>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5	Back alignment and domain information

>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase	Back alignment and domain information

>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2	Back alignment and domain information

>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase	Back alignment and domain information

>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins	Back alignment and domain information

>PTZ00266 NIMA-related protein kinase; Provisional	Back alignment and domain information

>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases	Back alignment and domain information

>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase	Back alignment and domain information

>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1	Back alignment and domain information

>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases	Back alignment and domain information

>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase	Back alignment and domain information

>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1	Back alignment and domain information

>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9	Back alignment and domain information

>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms]	Back alignment and domain information

>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase	Back alignment and domain information

>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases	Back alignment and domain information

>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6	Back alignment and domain information

>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4	Back alignment and domain information

>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6	Back alignment and domain information

>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein	Back alignment and domain information

>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11	Back alignment and domain information

>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase	Back alignment and domain information

>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase	Back alignment and domain information

>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9	Back alignment and domain information

>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4	Back alignment and domain information

>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase	Back alignment and domain information

>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1	Back alignment and domain information

>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases	Back alignment and domain information

>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity	Back alignment and domain information

>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases	Back alignment and domain information

>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1	Back alignment and domain information

>PHA03211 serine/threonine kinase US3; Provisional	Back alignment and domain information

>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase	Back alignment and domain information

>PLN00009 cyclin-dependent kinase A; Provisional	Back alignment and domain information

>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4	Back alignment and domain information

>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases	Back alignment and domain information

>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5	Back alignment and domain information

>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases	Back alignment and domain information

>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1	Back alignment and domain information

>PTZ00024 cyclin-dependent protein kinase; Provisional	Back alignment and domain information

>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases	Back alignment and domain information

>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism]	Back alignment and domain information

>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5	Back alignment and domain information

>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase	Back alignment and domain information

>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases	Back alignment and domain information

>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors	Back alignment and domain information

>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1	Back alignment and domain information

>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases	Back alignment and domain information

>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta	Back alignment and domain information

>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3	Back alignment and domain information

>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3	Back alignment and domain information

>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases	Back alignment and domain information

>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4	Back alignment and domain information

>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains	Back alignment and domain information

>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85	Back alignment and domain information

>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase	Back alignment and domain information

>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants	Back alignment and domain information

>KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms]	Back alignment and domain information

>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases	Back alignment and domain information

>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases	Back alignment and domain information

>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3	Back alignment and domain information

>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7	Back alignment and domain information

>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15	Back alignment and domain information

>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1	Back alignment and domain information

>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases	Back alignment and domain information

>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain	Back alignment and domain information

>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3	Back alignment and domain information

>PLN00181 protein SPA1-RELATED; Provisional	Back alignment and domain information

>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1	Back alignment and domain information

>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase	Back alignment and domain information

>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases	Back alignment and domain information

>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase	Back alignment and domain information

>KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms]	Back alignment and domain information

>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1	Back alignment and domain information

>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases	Back alignment and domain information

>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins	Back alignment and domain information

>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase	Back alignment and domain information

>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor	Back alignment and domain information

>PHA03210 serine/threonine kinase US3; Provisional	Back alignment and domain information

>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases	Back alignment and domain information

>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B	Back alignment and domain information

>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms]	Back alignment and domain information

>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only]	Back alignment and domain information

>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms]	Back alignment and domain information

>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C	Back alignment and domain information

>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12	Back alignment and domain information

>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases	Back alignment and domain information

>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor	Back alignment and domain information

>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors	Back alignment and domain information

>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2	Back alignment and domain information

>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6	Back alignment and domain information

>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase	Back alignment and domain information

>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1	Back alignment and domain information

>PLN03225 Serine/threonine-protein kinase SNT7; Provisional	Back alignment and domain information

>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase	Back alignment and domain information

>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7	Back alignment and domain information

>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase	Back alignment and domain information

>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor	Back alignment and domain information

>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase	Back alignment and domain information

>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases	Back alignment and domain information

>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7	Back alignment and domain information

>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases	Back alignment and domain information

>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A	Back alignment and domain information

>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn	Back alignment and domain information

>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10	Back alignment and domain information

>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10	Back alignment and domain information

>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1	Back alignment and domain information

>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron	Back alignment and domain information

>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros	Back alignment and domain information

>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases	Back alignment and domain information

>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription]	Back alignment and domain information

>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase	Back alignment and domain information

>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors	Back alignment and domain information

>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors	Back alignment and domain information

>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1	Back alignment and domain information

>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl	Back alignment and domain information

>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3	Back alignment and domain information

>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only]	Back alignment and domain information

>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk	Back alignment and domain information

>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit	Back alignment and domain information

>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3	Back alignment and domain information

>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk	Back alignment and domain information

>PHA02882 putative serine/threonine kinase; Provisional	Back alignment and domain information

>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity	Back alignment and domain information

>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome	Back alignment and domain information

>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase	Back alignment and domain information

>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa	Back alignment and domain information

>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase	Back alignment and domain information

>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases	Back alignment and domain information

>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification]	Back alignment and domain information

>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3	Back alignment and domain information

>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase)	Back alignment and domain information

>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk	Back alignment and domain information

>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes	Back alignment and domain information

>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase	Back alignment and domain information

>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors	Back alignment and domain information

>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases	Back alignment and domain information

>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor	Back alignment and domain information

>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2	Back alignment and domain information

>smart00219 TyrKc Tyrosine kinase, catalytic domain	Back alignment and domain information

>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1	Back alignment and domain information

>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms]	Back alignment and domain information

>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer	Back alignment and domain information

>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only]	Back alignment and domain information

>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases	Back alignment and domain information

>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4	Back alignment and domain information

>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases	Back alignment and domain information

>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1	Back alignment and domain information

>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4	Back alignment and domain information

>KOG0586 consensus Serine/threonine protein kinase [General function prediction only]	Back alignment and domain information

>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2	Back alignment and domain information

>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2	Back alignment and domain information

>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase	Back alignment and domain information

>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes	Back alignment and domain information

>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src	Back alignment and domain information

>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases	Back alignment and domain information

>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein	Back alignment and domain information

>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2	Back alignment and domain information

>KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2	Back alignment and domain information

>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1	Back alignment and domain information

>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase	Back alignment and domain information

>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases	Back alignment and domain information

>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3	Back alignment and domain information

>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases	Back alignment and domain information

>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases	Back alignment and domain information

>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase	Back alignment and domain information

>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha	Back alignment and domain information

>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta	Back alignment and domain information

>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases	Back alignment and domain information

>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2	Back alignment and domain information

>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors	Back alignment and domain information

>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms]	Back alignment and domain information

>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2	Back alignment and domain information

>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors	Back alignment and domain information

>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4	Back alignment and domain information

>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases	Back alignment and domain information

>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3	Back alignment and domain information

>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases	Back alignment and domain information

>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2	Back alignment and domain information

>PLN03224 probable serine/threonine protein kinase; Provisional	Back alignment and domain information

>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2	Back alignment and domain information

>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms]	Back alignment and domain information

>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>PRK13184 pknD serine/threonine-protein kinase; Reviewed	Back alignment and domain information

>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair]	Back alignment and domain information

>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms]	Back alignment and domain information

>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms]	Back alignment and domain information

>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms]	Back alignment and domain information

>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms]	Back alignment and domain information

>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms]	Back alignment and domain information

>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms]	Back alignment and domain information

>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases	Back alignment and domain information

>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3	Back alignment and domain information

>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription]	Back alignment and domain information

>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms]	Back alignment and domain information

>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms]	Back alignment and domain information

>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only]	Back alignment and domain information

>KOG1033 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms]	Back alignment and domain information

>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms]	Back alignment and domain information

>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms]	Back alignment and domain information

>cd00180 PKc Catalytic domain of Protein Kinases	Back alignment and domain information

>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>smart00221 STYKc Protein kinase; unclassified specificity	Back alignment and domain information

>KOG1023 consensus Natriuretic peptide receptor, guanylate cyclase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms]	Back alignment and domain information

>KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG4158 consensus BRPK/PTEN-induced protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A	Back alignment and domain information

>KOG1266 consensus Protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>PF12202 OSR1_C: Oxidative-stress-responsive kinase 1 C terminal; InterPro: IPR024678 Oxidative-stress-responsive kinase 1 (OSR1) is involved in the signalling cascade which activates Na/K/2Cl co-transporter during osmotic stress	Back alignment and domain information

>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG2137 consensus Protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>COG4248 Uncharacterized protein with protein kinase and helix-hairpin-helix DNA-binding domains [General function prediction only]	Back alignment and domain information

>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0584 consensus Serine/threonine protein kinase [General function prediction only]	Back alignment and domain information

Homologous Structure Templates