Citrus Sinensis ID: 014217


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------43
MAESKKEKKSSEERVKLFVGQVPKHMTEAQLLAMFKEFALVDEVNIIKDKTTRASRGCCFVICPSRQEADKAVNACHNKKTLPGASSPLQVKYADGELERLEHKLFIGMLPKNVSEAEVSALFSIYGTIKDLQILRGSQQTSKGCAFLKYETKEQALAALEAINGKHKMEGSSVPLVVKWADTEKERQARRAQKAQSQANNLPNADSQHPSLFGALPMGYAPPYNGYGYQASGSYGLMQYRLPPMQNQPGFHGIIPPVNQGNAMRGASPDLSSNMGPRNYAMPPSGFVGSGYPAVPGLQYPMPYPGGMLGHRPLNNSPGSVSPAVANSNPSTSSSGGTGPPGANLFIYHIPQEFGDQELGNAFQAFGRVLSAKVFVDKATGVSKCFGFVSYESPASAQNAIAMMNGCQLGGKKLKVQLKRDNKQNKPY
cccccccccccccccEEEEEcccccccHHHHHHHHHccccEEEEEEEEccccccccccEEEEcccHHHHHHHHHHHcccccccccccccEEcccccccccccccEEEEcccccccHHHHHHHHcccccEEEEEEEcccccccccEEEEEcccHHHHHHHHHHHccccccccccccEEEEEcccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccEEEEEEEEccccccccEEEEEEcccHHHHHHHHHHHHccccccEEEEEEEcccccccccc
***************KLFVGQVPKHMTEAQLLAMFKEFALVDEVNIIKDKTTRASRGCCFVICPSRQEADKAVNACHNKKTLPG*****QVKYADGELERLEHKLFIGMLPKNVSEAEVSALFSIYGTIKDLQILRGSQQTSKGCAFLKYETKEQALAALEAINGKHKMEGSSVPLVVKW*******************************LFGALPMGYAPPYNGYGYQASGSYGLMQYRLP*******FHGI***********GASPDLSSNMGPRNYAMPPSGFVGSGYPAVPGLQYPMPYPGGMLGHRPLNNSPGSVSPAV*************GPPGANLFIYHIPQEFGDQELGNAFQAFGRVLSAKVFVDKATGVSKCFGFVSYESPASAQNAIAMMNGCQLGGKKLKV************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAESKKEKKSSEERVKLFVGQVPKHMTEAQLLAMFKEFALVDEVNIIKDKTTRASRGCCFVICPSRQEADKAVNACHNKKTLPGASSPLQVKYADGELERLEHKLFIGMLPKNVSEAEVSALFSIYGTIKDLQILRGSQQTSKGCAFLKYETKEQALAALEAINGKHKMEGSSVPLVVKWADTEKERQARRAQKAQSQANNLPNADSQHPSLFGALPMGYAPPYNGYGYQASGSYGLMQYRLPPMQNQPGFHGIIPPVNQGNAMRGASPDLSSNMGPRNYAMPPSGFVGSGYPAVPGLQYPMPYPGGMLGHRPLNNSPGSVSPAVANSNPSTSSSGGTGPPGANLFIYHIPQEFGDQELGNAFQAFGRVLSAKVFVDKATGVSKCFGFVSYESPASAQNAIAMMNGCQLGGKKLKVQLKRDNKQNKPY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
CUGBP Elav-like family member 5 RNA-binding protein that may be implicated in the regulation of pre-mRNA alternative splicing.probableA0JM51

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3NMR, chain A
Confidence level:very confident
Coverage over the Query: 12-182
View the alignment between query and template
View the model in PyMOL
Template: 3NMR, chain A
Confidence level:very confident
Coverage over the Query: 102-186,338-420
View the alignment between query and template
View the model in PyMOL
Template: 2YH0, chain A
Confidence level:very confident
Coverage over the Query: 102-187,203-205,276-282,304-305,332-425
View the alignment between query and template
View the model in PyMOL
Template: 3PGW, chain A
Confidence level:very confident
Coverage over the Query: 100-194
View the alignment between query and template
View the model in PyMOL
Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 345-361
View the alignment between query and template
View the model in PyMOL