Citrus Sinensis ID: 014242


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------43
MTDAGLYEFEYGDCESSGLLHDENGFPSFQDNDDDDDDDEEEEEKEESFADDFYRCGTDWSCLLQTERKLKQANLFDMWGLKSNSESEANCLFSPPMKKLKASNGKSTATHLKKIVDRSCPFYKKIPGTPFTVDAFRYGSIKGCSAYFLTHFHYDHYGGLGKRWSHGPIYCSPLTARLVRMCLLVNPSYIHPLELNTEHVIDGVKVTLLEANHCPGAALIHFRLQDGQCYLHTGDFRASRLMQSYPLLVNHRVNVLYLDTTYCNPKYKFPSKEDVLNYVVRLTKNCLKKQPKTLVVVGAYSIGKESVFLAISKALGVKIYANASRRRVLQSFDWPELSGNLCTQGNDTLLHVLPMSSLKFETLKDYLKPYGNQYAAVLAFRPTGWTYSETVGNQLDLIRPLSRGNITIYGVPYSEHSSFTELREFVQV
ccccccccEEcccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccECccccEEEccccccccccccEEEEcccccHHccccccccccccEECcHHHHHHHHHHHccccccEEEccccCEEEEccEEEEEEEcccccccEEEEEEEcccEEEEEECccccccccccccccccccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHcccEEEEcHHHHHHHHHcccccccccccccccccCEEEcccccccHHHHHHHHHHcccccccEEEEEECccCECccccccccccccccccccEEEEEcccccccHHHHHHHHHc
******Y*FEYGDCE***********************************DDFYRCGTDWSCLLQTERKLKQANLFDMWGL***********************************DRSCPFYKKIPGTPFTVDAFRYGSIKGCSAYFLTHFHYDHYGGLGKRWSHGPIYCSPLTARLVRMCLLVNPSYIHPLELNTEHVIDGVKVTLLEANHCPGAALIHFRLQDGQCYLHTGDFRASRLMQSYPLLVNHRVNVLYLDTTYCNPKYKFPSKEDVLNYVVRLTKNCLKKQPKTLVVVGAYSIGKESVFLAISKALGVKIYANASRRRVLQSFDWPELSGNLCTQGNDTLLHVLPMSSLKFETLKDYLKPYGNQYAAVLAFRPTGWTYSETVGNQLDLIRPLSRGNITIYGVPYSEHSSFTELREFVQV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTDAGLYEFEYGDCESSGLLHDENGFPSFQDNDDDDDDDEEEEEKEESFADDFYRCGTDWSCLLQTERKLKQANLFDMWGLKSNSESEANCLFSPPMKKLKASNGKSTATHLKKIVDRSCPFYKKIPGTPFTVDAFRYGSIKGCSAYFLTHFHYDHYGGLGKRWSHGPIYCSPLTARLVRMCLLVNPSYIHPLELNTEHVIDGVKVTLLEANHCPGAALIHFRLQDGQCYLHTGDFRASRLMQSYPLLVNHRVNVLYLDTTYCNPKYKFPSKEDVLNYVVRLTKNCLKKQPKTLVVVGAYSIGKESVFLAISKALGVKIYANASRRRVLQSFDWPELSGNLCTQGNDTLLHVLPMSSLKFETLKDYLKPYGNQYAAVLAFRPTGWTYSETVGNQLDLIRPLSRGNITIYGVPYSEHSSFTELREFVQV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DNA cross-link repair protein SNM1 May be required for repair of DNA lesions formed after exposure to oxidative stress.probableQ38961

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XR1, chain A
Confidence level:very confident
Coverage over the Query: 111-427
View the alignment between query and template
View the model in PyMOL
Template: 3BV6, chain A
Confidence level:confident
Coverage over the Query: 58-262
View the alignment between query and template
View the model in PyMOL