Citrus Sinensis ID: 014258
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 428 | ||||||
| 255571754 | 582 | conserved hypothetical protein [Ricinus | 0.995 | 0.731 | 0.712 | 1e-172 | |
| 225460732 | 571 | PREDICTED: uncharacterized protein LOC10 | 0.992 | 0.744 | 0.669 | 1e-164 | |
| 356576153 | 569 | PREDICTED: uncharacterized protein LOC10 | 0.995 | 0.748 | 0.642 | 1e-164 | |
| 356535705 | 573 | PREDICTED: uncharacterized protein LOC10 | 0.995 | 0.743 | 0.652 | 1e-163 | |
| 224146396 | 584 | predicted protein [Populus trichocarpa] | 0.995 | 0.729 | 0.666 | 1e-150 | |
| 3335336 | 605 | Contains similarity to DnaJ gene YM8520. | 0.990 | 0.700 | 0.591 | 1e-147 | |
| 297837907 | 590 | hypothetical protein ARALYDRAFT_475539 [ | 0.990 | 0.718 | 0.620 | 1e-147 | |
| 449465354 | 597 | PREDICTED: uncharacterized protein LOC10 | 0.985 | 0.706 | 0.640 | 1e-146 | |
| 145337191 | 588 | DNAJ heat shock N-terminal domain-contai | 0.990 | 0.721 | 0.612 | 1e-146 | |
| 449496866 | 596 | PREDICTED: LOW QUALITY PROTEIN: uncharac | 0.985 | 0.708 | 0.636 | 1e-145 |
| >gi|255571754|ref|XP_002526820.1| conserved hypothetical protein [Ricinus communis] gi|223533824|gb|EEF35555.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 612 bits (1577), Expect = e-172, Method: Compositional matrix adjust.
Identities = 342/480 (71%), Positives = 379/480 (78%), Gaps = 54/480 (11%)
Query: 1 MSPEEVVRDVLTQFPNVGNDLKTLLQMIDDGQAVDIRGISEKSLIKHV------------ 48
++PE+VVRD+L +FPNVG+DLK LL+MIDDGQAVDI+GISE+SLIKH+
Sbjct: 105 INPEDVVRDMLKEFPNVGSDLKQLLEMIDDGQAVDIKGISERSLIKHLKKLFVSLNLKEN 164
Query: 49 --------------------------QPKESEAKD------------RLAADNN-LEMPG 69
+PKE + + +L+ DNN L M
Sbjct: 165 GDRVFLLPSNHCPTLEVVGHLINSHLEPKEQKRLNDVNSVPPAVESKKLSDDNNDLPMAS 224
Query: 70 PMDDPPGPQRRVIGPAMPSAELLAAAAKLTEAQAELRDAELEEDTELFIGPPPPAMVAEA 129
P DD GP+RR++GP MPSAELLAAAAKLTEAQAELR+ ELEEDTELFIGPPPPAMVAEA
Sbjct: 225 PGDDLSGPKRRMMGPEMPSAELLAAAAKLTEAQAELREVELEEDTELFIGPPPPAMVAEA 284
Query: 130 ETANEAERFEEVTRIMGVEGDCPYDVIGANHNMSAENIKKRYWKLSLFVHPDKCPHPQAH 189
E+ANEAERFEEVTRIM VE D PYDV+G NHNMSAENIKKRYWK+SL VHPDKC HPQAH
Sbjct: 285 ESANEAERFEEVTRIMAVEDDSPYDVVGVNHNMSAENIKKRYWKMSLLVHPDKCSHPQAH 344
Query: 190 QAFIKLNKAFKELQDPEKRKALDEKIKLKEEQEKFKVELKAMQEGAQWRKSQGILMEGDD 249
QAFIKLNKAFKELQDP+KRK LDE+IKLKEEQE FKVELKAM+E AQWR+ QGI MEGDD
Sbjct: 345 QAFIKLNKAFKELQDPDKRKLLDEQIKLKEEQEAFKVELKAMREAAQWRRLQGISMEGDD 404
Query: 250 ELLADMEVKAPPKRDEWMTTLPPERKPGGGVPMHSTKTFSRTSKEGRGDTSVWTDTPSDR 309
ELLA+MEVK P+RDEWMTTLPPERKP G+ M ST F + SKEGRGDTSVWTDTPSDR
Sbjct: 405 ELLAEMEVKVAPQRDEWMTTLPPERKP--GMTMQSTTRFGKCSKEGRGDTSVWTDTPSDR 462
Query: 310 AQKAKMNYLEAYSETSALASTEEEKKGARADADLVDKYNKEKRSKSLVQKHQEEGKTR-A 368
AQKAKMNYLEAY+E +AL S EEEK ADADLVDKYNK KRSKSLVQKHQEE R
Sbjct: 463 AQKAKMNYLEAYNEAAALVSNEEEKTKMSADADLVDKYNKAKRSKSLVQKHQEEAVNRSK 522
Query: 369 KKKSKQQPEKEEWVGEHPWKPWDREKDLVAGRQNIKFDSENMAEGLSSRFSSGNFQRNFL 428
KK +QQP+KEEWVG+HPWKPWDREKDLVAGRQNIKFDS+NMA+GLSSRFSSGNFQRNFL
Sbjct: 523 KKSKQQQPQKEEWVGQHPWKPWDREKDLVAGRQNIKFDSDNMAQGLSSRFSSGNFQRNFL 582
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225460732|ref|XP_002267868.1| PREDICTED: uncharacterized protein LOC100255442 [Vitis vinifera] gi|147843178|emb|CAN80552.1| hypothetical protein VITISV_004743 [Vitis vinifera] gi|296081144|emb|CBI18170.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356576153|ref|XP_003556198.1| PREDICTED: uncharacterized protein LOC100796738 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356535705|ref|XP_003536384.1| PREDICTED: uncharacterized protein LOC100788598 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224146396|ref|XP_002325992.1| predicted protein [Populus trichocarpa] gi|222862867|gb|EEF00374.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|3335336|gb|AAC27138.1| Contains similarity to DnaJ gene YM8520.10 gb|825566 from from S. cerevisiae cosmid gb|Z49705. ESTs gb|Z47720 and gb|Z29879 come from this gene [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297837907|ref|XP_002886835.1| hypothetical protein ARALYDRAFT_475539 [Arabidopsis lyrata subsp. lyrata] gi|297332676|gb|EFH63094.1| hypothetical protein ARALYDRAFT_475539 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|449465354|ref|XP_004150393.1| PREDICTED: uncharacterized protein LOC101213388 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|145337191|ref|NP_176707.3| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis thaliana] gi|110741606|dbj|BAE98751.1| hypothetical protein [Arabidopsis thaliana] gi|332196232|gb|AEE34353.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|449496866|ref|XP_004160248.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101213388 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 428 | ||||||
| TAIR|locus:2206285 | 588 | AT1G65280 [Arabidopsis thalian | 0.943 | 0.687 | 0.561 | 5.9e-135 | |
| MGI|MGI:1914717 | 346 | 1200011I18Rik "RIKEN cDNA 1200 | 0.390 | 0.482 | 0.326 | 1.6e-12 | |
| TAIR|locus:504956462 | 246 | AT5G22080 [Arabidopsis thalian | 0.268 | 0.467 | 0.333 | 1.7e-10 | |
| DICTYBASE|DDB_G0290017 | 176 | DDB_G0290017 "DnaJ homolog sub | 0.200 | 0.488 | 0.37 | 2.1e-09 | |
| ZFIN|ZDB-GENE-040801-212 | 405 | zgc:91844 "zgc:91844" [Danio r | 0.350 | 0.370 | 0.311 | 1.1e-08 | |
| FB|FBgn0037151 | 128 | CG7130 [Drosophila melanogaste | 0.142 | 0.476 | 0.426 | 1.2e-08 | |
| GENEDB_PFALCIPARUM|PF13_0036 | 322 | PF13_0036 "DNAJ protein, putat | 0.247 | 0.329 | 0.296 | 2e-08 | |
| UNIPROTKB|Q8IEP3 | 322 | PF13_0036 "DNAJ protein, putat | 0.247 | 0.329 | 0.296 | 2e-08 | |
| FB|FBgn0052640 | 132 | CG32640 [Drosophila melanogast | 0.151 | 0.492 | 0.369 | 2.1e-08 | |
| FB|FBgn0052641 | 132 | CG32641 [Drosophila melanogast | 0.151 | 0.492 | 0.369 | 2.1e-08 |
| TAIR|locus:2206285 AT1G65280 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1176 (419.0 bits), Expect = 5.9e-135, Sum P(2) = 5.9e-135
Identities = 237/422 (56%), Positives = 284/422 (67%)
Query: 15 PNVGNDLKTLLQMIDDGQAVDIRGISEKSLIKHVQPKESEAKDRLAADNNLEXXXXXXXX 74
P L + +I G+ D+ EKSL KE+E LA +N L
Sbjct: 177 PGASPSLDVVGHLIKGGEE-DV----EKSLDDSSPLKETEKG--LADENGL-GSNSADDV 228
Query: 75 XXXQRRVIGPAMPSXXXXXXXXXXXXXXXXXRDAELEEDTELFIGPPPPAMVAEAETANE 134
++RVIGPAMPS R+AELEED+E FIGP PPA+VAE ++NE
Sbjct: 229 TGPKKRVIGPAMPSAELLAAAAKLTEAQAELREAELEEDSEYFIGPAPPAVVAEVASSNE 288
Query: 135 AERFEEVTRIMGVEGDCPYDVIGANHNMSAENIKKRYWKLSLFVHPDKCPHPQAHQAFIK 194
AERFEEVTRIM + + PYDV+G NHNM+A+N+KKRYWKLSL VHPDKC HPQA +AF+
Sbjct: 289 AERFEEVTRIMEADANSPYDVLGVNHNMAADNMKKRYWKLSLLVHPDKCSHPQAQEAFVL 348
Query: 195 LNKAFKELQDPEKRKALDEKIKLKEEQEKFKVELKAMQEGAQWRKSQGILMEGDDELLAD 254
LNKAFKELQDPEKRKA+D+KIKLKEEQE FKVEL++MQE AQWR+SQGI MEGD ELLA
Sbjct: 349 LNKAFKELQDPEKRKAMDDKIKLKEEQEAFKVELRSMQEAAQWRRSQGISMEGDAELLAA 408
Query: 255 MEVKAPPKRDEWMTTLPPERKPGGGVPMHSTKTFSRTSKEGRGDTSVWTDTPSDRAQKAK 314
EVK PKRDEWMTTLPPERK G V + + TFSR ++EGRGDT+ WTDTP D+A++AK
Sbjct: 409 TEVKPEPKRDEWMTTLPPERKVG--VAVQQSTTFSRNAREGRGDTTAWTDTPMDKAERAK 466
Query: 315 MNYXXXXXXXXXXXXXXXXKKGARADADLVDKYNKEKRSKSLVQKHQEEG--------KT 366
MNY DA+LVDKYNKEKR+KSLV+KH+E+ K
Sbjct: 467 MNYLEAYNKASALASNEGENMKRSMDAELVDKYNKEKRAKSLVEKHREDSSSSSSRLKKK 526
Query: 367 RAXXXXXXXXXXXXWVGEHPWKPWDREKDLVAGRQNIKFDSENMAEGLSSRFSSGNFQRN 426
+ WVG+HPWKPWDRE DL AGRQN+K D++ MAEGL+S+FSSGNFQR+
Sbjct: 527 KKLSSSKEKTEKDEWVGKHPWKPWDRENDLTAGRQNVKLDADGMAEGLASKFSSGNFQRS 586
Query: 427 FL 428
FL
Sbjct: 587 FL 588
|
|
| MGI|MGI:1914717 1200011I18Rik "RIKEN cDNA 1200011I18 gene" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:504956462 AT5G22080 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0290017 DDB_G0290017 "DnaJ homolog subfamily C member 5B" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040801-212 zgc:91844 "zgc:91844" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0037151 CG7130 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| GENEDB_PFALCIPARUM|PF13_0036 PF13_0036 "DNAJ protein, putative" [Plasmodium falciparum (taxid:5833)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8IEP3 PF13_0036 "DNAJ protein, putative" [Plasmodium falciparum 3D7 (taxid:36329)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0052640 CG32640 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0052641 CG32641 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00031820001 | SubName- Full=Putative uncharacterized protein (Chromosome chr18 scaffold_59, whole genome shotgun sequence); (571 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00021809001 | • | 0.472 | |||||||||
| GSVIVG00038542001 | • | 0.429 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 428 | |||
| pfam12572 | 148 | pfam12572, DUF3752, Protein of unknown function (D | 8e-33 | |
| pfam00226 | 63 | pfam00226, DnaJ, DnaJ domain | 5e-16 | |
| cd06257 | 55 | cd06257, DnaJ, DnaJ domain or J-domain | 1e-14 | |
| smart00271 | 60 | smart00271, DnaJ, DnaJ molecular chaperone homolog | 4e-13 | |
| COG0484 | 371 | COG0484, DnaJ, DnaJ-class molecular chaperone with | 1e-11 | |
| PRK14291 | 382 | PRK14291, PRK14291, chaperone protein DnaJ; Provis | 3e-10 | |
| TIGR02349 | 354 | TIGR02349, DnaJ_bact, chaperone protein DnaJ | 1e-09 | |
| PRK14292 | 371 | PRK14292, PRK14292, chaperone protein DnaJ; Provis | 4e-08 | |
| PRK14298 | 377 | PRK14298, PRK14298, chaperone protein DnaJ; Provis | 8e-08 | |
| PRK14276 | 380 | PRK14276, PRK14276, chaperone protein DnaJ; Provis | 8e-08 | |
| COG2214 | 237 | COG2214, CbpA, DnaJ-class molecular chaperone [Pos | 1e-07 | |
| PRK14301 | 373 | PRK14301, PRK14301, chaperone protein DnaJ; Provis | 5e-07 | |
| PRK14277 | 386 | PRK14277, PRK14277, chaperone protein DnaJ; Provis | 7e-07 | |
| PRK14284 | 391 | PRK14284, PRK14284, chaperone protein DnaJ; Provis | 7e-07 | |
| PRK14278 | 378 | PRK14278, PRK14278, chaperone protein DnaJ; Provis | 8e-07 | |
| PRK14299 | 291 | PRK14299, PRK14299, chaperone protein DnaJ; Provis | 1e-06 | |
| PRK14294 | 366 | PRK14294, PRK14294, chaperone protein DnaJ; Provis | 1e-06 | |
| PRK14287 | 371 | PRK14287, PRK14287, chaperone protein DnaJ; Provis | 2e-06 | |
| PRK14279 | 392 | PRK14279, PRK14279, chaperone protein DnaJ; Provis | 3e-06 | |
| PRK14283 | 378 | PRK14283, PRK14283, chaperone protein DnaJ; Provis | 4e-06 | |
| PRK14281 | 397 | PRK14281, PRK14281, chaperone protein DnaJ; Provis | 7e-06 | |
| PRK14290 | 365 | PRK14290, PRK14290, chaperone protein DnaJ; Provis | 7e-06 | |
| PRK10767 | 371 | PRK10767, PRK10767, chaperone protein DnaJ; Provis | 9e-06 | |
| PRK14289 | 386 | PRK14289, PRK14289, chaperone protein DnaJ; Provis | 1e-05 | |
| PTZ00037 | 421 | PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov | 1e-05 | |
| PRK14297 | 380 | PRK14297, PRK14297, chaperone protein DnaJ; Provis | 1e-05 | |
| PRK14280 | 376 | PRK14280, PRK14280, chaperone protein DnaJ; Provis | 2e-05 | |
| PRK14286 | 372 | PRK14286, PRK14286, chaperone protein DnaJ; Provis | 2e-05 | |
| PRK14296 | 372 | PRK14296, PRK14296, chaperone protein DnaJ; Provis | 3e-05 | |
| PRK14293 | 374 | PRK14293, PRK14293, chaperone protein DnaJ; Provis | 3e-05 | |
| PRK14300 | 372 | PRK14300, PRK14300, chaperone protein DnaJ; Provis | 8e-05 | |
| PRK14282 | 369 | PRK14282, PRK14282, chaperone protein DnaJ; Provis | 1e-04 | |
| PRK14295 | 389 | PRK14295, PRK14295, chaperone protein DnaJ; Provis | 2e-04 | |
| COG5407 | 610 | COG5407, SEC63, Preprotein translocase subunit Sec | 0.001 | |
| TIGR03835 | 871 | TIGR03835, termin_org_DnaJ, terminal organelle ass | 0.003 |
| >gnl|CDD|221643 pfam12572, DUF3752, Protein of unknown function (DUF3752) | Back alignment and domain information |
|---|
Score = 120 bits (303), Expect = 8e-33
Identities = 52/157 (33%), Positives = 82/157 (52%), Gaps = 16/157 (10%)
Query: 271 PPERKPGGGVPMHS---TKTFSRTSKEGRGDTSVWTDTPSDRAQKAKMNYLEAYSETSAL 327
PPER + + FS +K RGD S WT+TP ++A++ + L + SA
Sbjct: 1 PPERSDLNSRVDPTKLRNRKFSTGTKSARGDDSSWTETPEEKAKRLQDEVLGVEAGASAP 60
Query: 328 A-STEEEKKGARADADLVDKYNKEKRSKSLVQKHQEEGKTRAKKKSKQQPEKEEWVGEHP 386
A ++ + K + A V +YN++KR KSLV++HQ++ +++ +KEE +
Sbjct: 61 AAASAKASKRDKEMARKVKEYNEKKRGKSLVEQHQKK---------QKKKKKEEENDDPS 111
Query: 387 WKPWDREKDLVAGRQNIKFDSENM---AEGLSSRFSS 420
+P+DREKDL G + K + A L SRFSS
Sbjct: 112 RRPFDREKDLAVGGKISKAQRRELINKAAELGSRFSS 148
|
This domain family is found in eukaryotes, and is typically between 140 and 163 amino acids in length. Length = 148 |
| >gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain | Back alignment and domain information |
|---|
| >gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ | Back alignment and domain information |
|---|
| >gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 428 | |||
| KOG4188 | 159 | consensus Uncharacterized conserved protein [Funct | 100.0 | |
| PF12572 | 152 | DUF3752: Protein of unknown function (DUF3752); In | 99.97 | |
| COG0484 | 371 | DnaJ DnaJ-class molecular chaperone with C-termina | 99.86 | |
| KOG0713 | 336 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.84 | |
| KOG0712 | 337 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.75 | |
| PRK14288 | 369 | chaperone protein DnaJ; Provisional | 99.74 | |
| PRK14296 | 372 | chaperone protein DnaJ; Provisional | 99.74 | |
| KOG0691 | 296 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.71 | |
| PTZ00037 | 421 | DnaJ_C chaperone protein; Provisional | 99.7 | |
| PRK14279 | 392 | chaperone protein DnaJ; Provisional | 99.69 | |
| PRK14286 | 372 | chaperone protein DnaJ; Provisional | 99.69 | |
| PRK14287 | 371 | chaperone protein DnaJ; Provisional | 99.69 | |
| PRK14283 | 378 | chaperone protein DnaJ; Provisional | 99.68 | |
| PRK14276 | 380 | chaperone protein DnaJ; Provisional | 99.67 | |
| PF00226 | 64 | DnaJ: DnaJ domain; InterPro: IPR001623 The prokary | 99.67 | |
| PRK14299 | 291 | chaperone protein DnaJ; Provisional | 99.67 | |
| PRK14298 | 377 | chaperone protein DnaJ; Provisional | 99.67 | |
| PRK14291 | 382 | chaperone protein DnaJ; Provisional | 99.67 | |
| PRK14282 | 369 | chaperone protein DnaJ; Provisional | 99.66 | |
| PRK14278 | 378 | chaperone protein DnaJ; Provisional | 99.66 | |
| PRK14280 | 376 | chaperone protein DnaJ; Provisional | 99.66 | |
| PRK14294 | 366 | chaperone protein DnaJ; Provisional | 99.65 | |
| PRK14277 | 386 | chaperone protein DnaJ; Provisional | 99.65 | |
| PRK14285 | 365 | chaperone protein DnaJ; Provisional | 99.65 | |
| KOG0719 | 264 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.65 | |
| KOG0716 | 279 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.65 | |
| PTZ00341 | 1136 | Ring-infected erythrocyte surface antigen; Provisi | 99.64 | |
| PRK14284 | 391 | chaperone protein DnaJ; Provisional | 99.64 | |
| PRK14297 | 380 | chaperone protein DnaJ; Provisional | 99.63 | |
| PRK14295 | 389 | chaperone protein DnaJ; Provisional | 99.63 | |
| KOG0718 | 546 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.63 | |
| PRK14301 | 373 | chaperone protein DnaJ; Provisional | 99.63 | |
| PRK14281 | 397 | chaperone protein DnaJ; Provisional | 99.62 | |
| PRK10767 | 371 | chaperone protein DnaJ; Provisional | 99.62 | |
| TIGR02349 | 354 | DnaJ_bact chaperone protein DnaJ. This model repre | 99.61 | |
| PRK14300 | 372 | chaperone protein DnaJ; Provisional | 99.6 | |
| KOG0717 | 508 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.6 | |
| PRK10266 | 306 | curved DNA-binding protein CbpA; Provisional | 99.6 | |
| PRK14292 | 371 | chaperone protein DnaJ; Provisional | 99.6 | |
| PRK14293 | 374 | chaperone protein DnaJ; Provisional | 99.6 | |
| KOG0715 | 288 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.6 | |
| PRK14289 | 386 | chaperone protein DnaJ; Provisional | 99.59 | |
| PRK14290 | 365 | chaperone protein DnaJ; Provisional | 99.58 | |
| smart00271 | 60 | DnaJ DnaJ molecular chaperone homology domain. | 99.55 | |
| cd06257 | 55 | DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho | 99.53 | |
| TIGR03835 | 871 | termin_org_DnaJ terminal organelle assembly protei | 99.51 | |
| KOG0720 | 490 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.5 | |
| COG2214 | 237 | CbpA DnaJ-class molecular chaperone [Posttranslati | 99.46 | |
| PHA03102 | 153 | Small T antigen; Reviewed | 99.46 | |
| KOG0721 | 230 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.45 | |
| PRK05014 | 171 | hscB co-chaperone HscB; Provisional | 99.34 | |
| PRK01356 | 166 | hscB co-chaperone HscB; Provisional | 99.34 | |
| PRK00294 | 173 | hscB co-chaperone HscB; Provisional | 99.31 | |
| PRK03578 | 176 | hscB co-chaperone HscB; Provisional | 99.26 | |
| KOG0722 | 329 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.25 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 99.24 | |
| KOG0714 | 306 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.13 | |
| PHA02624 | 647 | large T antigen; Provisional | 99.13 | |
| KOG1150 | 250 | consensus Predicted molecular chaperone (DnaJ supe | 99.12 | |
| PTZ00100 | 116 | DnaJ chaperone protein; Provisional | 99.06 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.05 | |
| PRK09430 | 267 | djlA Dna-J like membrane chaperone protein; Provis | 99.05 | |
| PRK01773 | 173 | hscB co-chaperone HscB; Provisional | 98.93 | |
| COG5407 | 610 | SEC63 Preprotein translocase subunit Sec63 [Intrac | 98.84 | |
| TIGR00714 | 157 | hscB Fe-S protein assembly co-chaperone HscB. This | 98.82 | |
| COG5269 | 379 | ZUO1 Ribosome-associated chaperone zuotin [Transla | 98.62 | |
| KOG1789 | 2235 | consensus Endocytosis protein RME-8, contains DnaJ | 98.34 | |
| KOG0568 | 342 | consensus Molecular chaperone (DnaJ superfamily) [ | 97.98 | |
| KOG0723 | 112 | consensus Molecular chaperone (DnaJ superfamily) [ | 97.05 | |
| KOG3192 | 168 | consensus Mitochondrial J-type chaperone [Posttran | 96.8 | |
| KOG0431 | 453 | consensus Auxilin-like protein and related protein | 95.59 | |
| COG1076 | 174 | DjlA DnaJ-domain-containing proteins 1 [Posttransl | 95.33 | |
| COG1076 | 174 | DjlA DnaJ-domain-containing proteins 1 [Posttransl | 94.8 | |
| PF12339 | 132 | DNAJ_related: DNA-J related protein ; InterPro: IP | 94.51 | |
| PF03656 | 127 | Pam16: Pam16; InterPro: IPR005341 The Pam16 protei | 90.49 |
| >KOG4188 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.4e-39 Score=281.04 Aligned_cols=156 Identities=49% Similarity=0.810 Sum_probs=133.2
Q ss_pred CccccccccCCCCCCCCCCCCCCccccccCCCCCCCCCCCCCCCChHHHHHHHHhhhhhhhhhcccccchHHHhhhhhhH
Q 014258 261 PKRDEWMTTLPPERKPGGGVPMHSTKTFSRTSKEGRGDTSVWTDTPSDRAQKAKMNYLEAYSETSALASTEEEKKGARAD 340 (428)
Q Consensus 261 ~~re~WM~~lPp~~~~~~~~~~~~~R~F~~~~~~~~gd~S~WTeTP~ek~kR~~~~~l~~~~~~~~~~~~~~~~~~~~~~ 340 (428)
|+||+|||+|||.+..+ |++.+ +|+|.++...++||+|+||+||.+|.+|+++..+.+++..++..+...+.-+..++
T Consensus 2 pkReeWMt~lP~e~~~~-gl~~~-~rTFkrga~~~sgd~ssWtdtP~dke~rak~t~~ars~sskale~~~~~~~~~~rd 79 (159)
T KOG4188|consen 2 PKREEWMTTLPPERKVF-GLGQQ-SRTFKRGAREGSGDRSSWTDTPMDKERRAKETYLARSNSSKALESNEGENMKRSRD 79 (159)
T ss_pred chHHHHHHhCCchhccc-ccccc-chhhhcccccCCCcccccccCcccHHHHHHhhhhhhhhhhHHHHHhhhhhhhhhhh
Confidence 58999999999999987 77754 89999999989999999999999999999998887777666665555555566789
Q ss_pred HHHHHHHHhhccCchhHHhhHHhhhhhhhhccCCCcccccccCCCCCCCCchhhhhhcCccc--ccccHHHHhcccCCCC
Q 014258 341 ADLVDKYNKEKRSKSLVQKHQEEGKTRAKKKSKQQPEKEEWVGEHPWKPWDREKDLVAGRQN--IKFDSENMAEGLSSRF 418 (428)
Q Consensus 341 ~~~v~~~n~~~R~~SL~e~Hq~k~~~~~~~~~~~~~~ke~~~~d~p~rpFDRekDl~~~~~~--~~~~~~~ka~~l~sRF 418 (428)
+++|+.||+++|++||||+||+++.++.+ .+|...++|||||||+||.|++++ ...+.+.+|+.|++||
T Consensus 80 aeqvs~~nkkkr~eSLvEiHqkk~~sK~k---------d~~~~q~errPfdRekDlkv~r~d~n~kk~avdkak~latkF 150 (159)
T KOG4188|consen 80 AEQVSKYNKKKRAESLVEIHQKKLSSKEK---------DEWKPQHERRPFDREKDLKVNRQDPNQKKDAVDKAKELATKF 150 (159)
T ss_pred HHHHHHHHhhhcchHHHHHHHHHHhHHHH---------hcccCcccCCCccccccccccccCcchhHHHHHHHHHHHHHh
Confidence 99999999999999999999999987532 234456789999999999999984 4455679999999999
Q ss_pred CCCccccCCC
Q 014258 419 SSGNFQRNFL 428 (428)
Q Consensus 419 s~G~~~r~FL 428 (428)
|+|+|| .||
T Consensus 151 s~gk~q-rfl 159 (159)
T KOG4188|consen 151 SSGKFQ-RFL 159 (159)
T ss_pred ccCccc-ccC
Confidence 999999 565
|
|
| >PF12572 DUF3752: Protein of unknown function (DUF3752); InterPro: IPR022226 This domain family is found in eukaryotes, and is typically between 140 and 163 amino acids in length | Back alignment and domain information |
|---|
| >COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14288 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14296 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00037 DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PRK14279 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14286 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14287 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14283 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14276 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] | Back alignment and domain information |
|---|
| >PRK14299 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14298 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14291 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14282 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14278 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14280 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14294 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14277 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14285 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00341 Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >PRK14284 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14297 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14295 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14301 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14281 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10767 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >TIGR02349 DnaJ_bact chaperone protein DnaJ | Back alignment and domain information |
|---|
| >PRK14300 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10266 curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >PRK14292 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14293 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14289 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14290 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >smart00271 DnaJ DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >cd06257 DnaJ DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA03102 Small T antigen; Reviewed | Back alignment and domain information |
|---|
| >KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05014 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK01356 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK00294 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK03578 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02624 large T antigen; Provisional | Back alignment and domain information |
|---|
| >KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00100 DnaJ chaperone protein; Provisional | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK09430 djlA Dna-J like membrane chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PRK01773 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR00714 hscB Fe-S protein assembly co-chaperone HscB | Back alignment and domain information |
|---|
| >COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] | Back alignment and domain information |
|---|
| >COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12339 DNAJ_related: DNA-J related protein ; InterPro: IPR021059 This domain family is approximately 130 amino acids in length and contains a conserved YYLD sequence motif | Back alignment and domain information |
|---|
| >PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 428 | ||||
| 2ctp_A | 78 | Solution Structure Of J-Domain From Human Dnaj Subf | 8e-07 | ||
| 2ctw_A | 109 | Solution Structure Of J-Domain From Mouse Dnaj Subf | 2e-06 | ||
| 3apq_A | 210 | Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt | 2e-06 | ||
| 3apo_A | 780 | Crystal Structure Of Full-Length Erdj5 Length = 780 | 3e-06 | ||
| 2cug_A | 88 | Solution Structure Of The J Domain Of The Pseudo Dn | 5e-06 | ||
| 2lo1_A | 71 | Nmr Structure Of The Protein Bc008182, A Dnaj-Like | 3e-05 | ||
| 2ctr_A | 88 | Solution Structure Of J-Domain From Human Dnaj Subf | 7e-05 | ||
| 1hdj_A | 77 | Human Hsp40 (Hdj-1), Nmr Length = 77 | 9e-05 | ||
| 2dmx_A | 92 | Solution Structure Of The J Domain Of Dnaj Homolog | 2e-04 | ||
| 2och_A | 73 | J-domain Of Dnj-12 From Caenorhabditis Elegans Leng | 2e-04 | ||
| 2dn9_A | 79 | Solution Structure Of J-Domain From The Dnaj Homolo | 3e-04 |
| >pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 | Back alignment and structure |
|
| >pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 | Back alignment and structure |
| >pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 | Back alignment and structure |
| >pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 | Back alignment and structure |
| >pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 | Back alignment and structure |
| >pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 | Back alignment and structure |
| >pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 | Back alignment and structure |
| >pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 | Back alignment and structure |
| >pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 | Back alignment and structure |
| >pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 | Back alignment and structure |
| >pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 428 | |||
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 4e-14 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 7e-12 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 4e-11 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 7e-11 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 9e-11 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 2e-10 | |
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 9e-10 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 1e-09 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 3e-09 | |
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 3e-09 | |
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 4e-09 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 6e-09 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 7e-09 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 8e-09 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 3e-08 | |
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 3e-08 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 4e-08 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 4e-08 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 9e-08 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 1e-07 | |
| 1n4c_A | 182 | Auxilin; four helix bundle, protein binding; NMR { | 3e-07 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 4e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-07 | |
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 7e-07 | |
| 2qwo_B | 92 | Putative tyrosine-protein phosphatase auxilin; cha | 2e-06 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 3e-06 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 3e-06 | |
| 3uo3_A | 181 | J-type CO-chaperone JAC1, mitochondrial; structura | 4e-06 | |
| 1fpo_A | 171 | HSC20, chaperone protein HSCB; molecular chaperone | 2e-05 | |
| 3ag7_A | 106 | Putative uncharacterized protein F9E10.5; J-domain | 2e-05 | |
| 3hho_A | 174 | CO-chaperone protein HSCB homolog; structural geno | 6e-05 | |
| 1iur_A | 88 | KIAA0730 protein; DNAJ like domain, riken structur | 2e-04 |
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
Score = 66.7 bits (163), Expect = 4e-14
Identities = 21/75 (28%), Positives = 35/75 (46%), Gaps = 2/75 (2%)
Query: 135 AERFEEVTRIMGVEGDCPYDVIGANHNMSAENIKKRYWKLSLFVHPDKCPHPQAHQAFIK 194
E+ + + RI + +D++G S + + K Y KL++ +HPDKC P + AF
Sbjct: 14 KEQADAIRRIRNSKD--SWDMLGVKPGASRDEVNKAYRKLAVLLHPDKCVAPGSEDAFKA 71
Query: 195 LNKAFKELQDPEKRK 209
+ A L K
Sbjct: 72 VVNARTALLKNIKSG 86
|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 | Back alignment and structure |
|---|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 | Back alignment and structure |
|---|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 | Back alignment and structure |
|---|
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 | Back alignment and structure |
|---|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 | Back alignment and structure |
|---|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 | Back alignment and structure |
|---|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 | Back alignment and structure |
|---|
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 | Back alignment and structure |
|---|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 | Back alignment and structure |
|---|
| >2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 | Back alignment and structure |
|---|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 | Back alignment and structure |
|---|
| >1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 | Back alignment and structure |
|---|
| >3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 | Back alignment and structure |
|---|
| >1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 428 | |||
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 99.78 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 99.78 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 99.77 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 99.77 | |
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 99.76 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 99.75 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 99.75 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 99.75 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 99.75 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 99.75 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 99.74 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 99.74 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 99.73 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 99.72 | |
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 99.72 | |
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 99.72 | |
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 99.7 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 99.64 | |
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 99.64 | |
| 3hho_A | 174 | CO-chaperone protein HSCB homolog; structural geno | 99.61 | |
| 1fpo_A | 171 | HSC20, chaperone protein HSCB; molecular chaperone | 99.59 | |
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 99.58 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 99.55 | |
| 3bvo_A | 207 | CO-chaperone protein HSCB, mitochondrial precurso; | 99.54 | |
| 1iur_A | 88 | KIAA0730 protein; DNAJ like domain, riken structur | 99.53 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 99.53 | |
| 1faf_A | 79 | Large T antigen; J domain, HPD motif, anti-paralle | 99.52 | |
| 1n4c_A | 182 | Auxilin; four helix bundle, protein binding; NMR { | 99.52 | |
| 3uo3_A | 181 | J-type CO-chaperone JAC1, mitochondrial; structura | 99.51 | |
| 2qwo_B | 92 | Putative tyrosine-protein phosphatase auxilin; cha | 99.5 | |
| 3ag7_A | 106 | Putative uncharacterized protein F9E10.5; J-domain | 99.49 | |
| 2guz_A | 71 | Mitochondrial import inner membrane translocase su | 99.43 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 99.39 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 98.82 | |
| 2guz_B | 65 | Mitochondrial import inner membrane translocase su | 98.47 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 85.04 |
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
Probab=99.78 E-value=2e-19 Score=143.29 Aligned_cols=70 Identities=33% Similarity=0.527 Sum_probs=66.5
Q ss_pred CCCcccccCCCCCCCHHHHHHHHHHHHHhhCCCCCCChHHHHHHHHHHHHHHHhcChhHHHHHHHHhhhH
Q 014258 149 GDCPYDVIGANHNMSAENIKKRYWKLSLFVHPDKCPHPQAHQAFIKLNKAFKELQDPEKRKALDEKIKLK 218 (428)
Q Consensus 149 ~~d~Y~vLgv~~~as~~eIKkaYrkla~~~HPDk~~~~~a~e~F~~I~~AYevLsDp~kR~~YD~~~~~~ 218 (428)
..|||+||||+++++.++||++|++|+++||||+++.+.+.+.|+.|++||++|+||.+|..||.++..+
T Consensus 2 ~~~~y~iLgv~~~as~~~Ik~ayr~l~~~~HPD~~~~~~~~~~f~~i~~Ay~~L~d~~~R~~Yd~~~~~~ 71 (77)
T 1hdj_A 2 GKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEG 71 (77)
T ss_dssp CCCSHHHHTCCTTCCHHHHHHHHHHHHHTTCTTTCCCTTHHHHHHHHHHHHHHTTCHHHHHHHHHTCGGG
T ss_pred CCCHHHHcCCCCCCCHHHHHHHHHHHHHHHCcCCCCCccHHHHHHHHHHHHHHHCCHHHHHHHHHHcccc
Confidence 3689999999999999999999999999999999998899999999999999999999999999988654
|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A | Back alignment and structure |
|---|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} | Back alignment and structure |
|---|
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 | Back alignment and structure |
|---|
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A | Back alignment and structure |
|---|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C | Back alignment and structure |
|---|
| >1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J | Back alignment and structure |
|---|
| >3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A | Back alignment and structure |
|---|
| >2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A | Back alignment and structure |
|---|
| >3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 428 | ||||
| d1nz6a_ | 98 | a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T | 8e-10 | |
| d1hdja_ | 77 | a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 | 6e-09 | |
| d1wjza_ | 94 | a.2.3.1 (A:) CSL-type zinc finger-containing prote | 7e-08 | |
| d1fpoa1 | 76 | a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma | 9e-08 | |
| d1xbla_ | 75 | a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain | 5e-07 | |
| d1fafa_ | 79 | a.2.3.1 (A:) Large T antigen, the N-terminal J dom | 2e-06 | |
| d1iura_ | 88 | a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human | 9e-05 | |
| d1gh6a_ | 114 | a.2.3.1 (A:) Large T antigen, the N-terminal J dom | 0.001 |
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Long alpha-hairpin superfamily: Chaperone J-domain family: Chaperone J-domain domain: Auxilin J-domain species: Cow (Bos taurus) [TaxId: 9913]
Score = 53.4 bits (128), Expect = 8e-10
Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 4/67 (5%)
Query: 148 EGDCPYDVIGANHNMSAENIKKRYWKLSLFVHPDKCPHPQAHQA----FIKLNKAFKELQ 203
G+ + +G ++ E +KK Y K L VHPDK Q F++LN A+ E +
Sbjct: 31 AGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPDKATGQPYEQYAKMIFMELNDAWSEFE 90
Query: 204 DPEKRKA 210
+ ++
Sbjct: 91 NQGQKPL 97
|
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 | Back information, alignment and structure |
|---|
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 | Back information, alignment and structure |
|---|
| >d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 428 | |||
| d1xbla_ | 75 | DnaJ chaperone, N-terminal (J) domain {Escherichia | 99.82 | |
| d1hdja_ | 77 | HSP40 {Human (Homo sapiens) [TaxId: 9606]} | 99.8 | |
| d1wjza_ | 94 | CSL-type zinc finger-containing protein 3 (J-domai | 99.74 | |
| d1gh6a_ | 114 | Large T antigen, the N-terminal J domain {Simian v | 99.68 | |
| d1fpoa1 | 76 | HSC20 (HSCB), N-terminal (J) domain {Escherichia c | 99.61 | |
| d1fafa_ | 79 | Large T antigen, the N-terminal J domain {Murine p | 99.57 | |
| d1nz6a_ | 98 | Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | 99.52 | |
| d1iura_ | 88 | Hypothetical protein KIAA0730 {Human (Homo sapiens | 99.42 |
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Long alpha-hairpin superfamily: Chaperone J-domain family: Chaperone J-domain domain: DnaJ chaperone, N-terminal (J) domain species: Escherichia coli [TaxId: 562]
Probab=99.82 E-value=7.7e-21 Score=149.68 Aligned_cols=70 Identities=26% Similarity=0.464 Sum_probs=65.2
Q ss_pred CCCcccccCCCCCCCHHHHHHHHHHHHHhhCCCCCCC-hHHHHHHHHHHHHHHHhcChhHHHHHHHHhhhH
Q 014258 149 GDCPYDVIGANHNMSAENIKKRYWKLSLFVHPDKCPH-PQAHQAFIKLNKAFKELQDPEKRKALDEKIKLK 218 (428)
Q Consensus 149 ~~d~Y~vLgv~~~as~~eIKkaYrkla~~~HPDk~~~-~~a~e~F~~I~~AYevLsDp~kR~~YD~~~~~~ 218 (428)
..|||+||||+++||.++||+||++++++||||+++. +.+.+.|..|++||+||+||.+|..||.+|..+
T Consensus 2 k~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~~ 72 (75)
T d1xbla_ 2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAA 72 (75)
T ss_dssp CCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTTCHHHHHHHHHHHHHHHTTSSHHHHHHHHHTTSS
T ss_pred CCCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCChHHHHHHHHHHHHHHhcCCHHHHHHHHHhCccc
Confidence 4799999999999999999999999999999999984 678889999999999999999999999988643
|
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} | Back information, alignment and structure |
|---|
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|