BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 014271
         (427 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1IRZ|A Chain A, Solution Structure Of Arr10-B Belonging To The Garp Family
           Of Plant Myb-Related Dna Binding Motifs Of The
           Arabidopsis Response Regulators
          Length = 64

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 40/60 (66%), Gaps = 1/60 (1%)

Query: 184 TPANKSRMRWTPELHEAFVEAVNRLGGGERATPKGVLKLMNVENLTIYHVKSHLQKYRTA 243
           T   K R+ WT ELH  F+ AV+ LG  ERA PK +L LMNV+ LT  +V SHLQK+R A
Sbjct: 1   TAQKKPRVLWTHELHNKFLAAVDHLGV-ERAVPKKILDLMNVDKLTRENVASHLQKFRVA 59


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.307    0.123    0.345 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 12,265,116
Number of Sequences: 62578
Number of extensions: 496924
Number of successful extensions: 856
Number of sequences better than 100.0: 11
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 9
Number of HSP's that attempted gapping in prelim test: 852
Number of HSP's gapped (non-prelim): 12
length of query: 427
length of database: 14,973,337
effective HSP length: 102
effective length of query: 325
effective length of database: 8,590,381
effective search space: 2791873825
effective search space used: 2791873825
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 53 (25.0 bits)