Query         014310
Match_columns 427
No_of_seqs    187 out of 934
Neff          4.7 
Searched_HMMs 46136
Date          Fri Mar 29 03:53:35 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/014310.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/014310hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02365 NAM:  No apical merist 100.0 6.3E-39 1.4E-43  280.1   6.6  127   58-198     1-129 (129)
  2 PF09889 DUF2116:  Uncharacteri  50.1     8.4 0.00018   30.5   1.1   15   34-48      1-15  (59)
  3 PF13248 zf-ribbon_3:  zinc-rib  49.9     8.7 0.00019   25.2   1.0   12   37-48      3-14  (26)
  4 PF03604 DNA_RNApol_7kD:  DNA d  47.0      12 0.00025   26.2   1.3   16   31-46     12-27  (32)
  5 PF13240 zinc_ribbon_2:  zinc-r  43.3      12 0.00026   24.1   0.9   13   38-50      1-13  (23)
  6 smart00659 RPOLCX RNA polymera  42.8      15 0.00032   27.3   1.4   16   32-47     15-30  (44)
  7 PF10571 UPF0547:  Uncharacteri  32.6      20 0.00044   23.8   0.7   11   37-47      1-11  (26)
  8 PF00301 Rubredoxin:  Rubredoxi  30.1      21 0.00045   27.0   0.5   27   38-65      3-29  (47)
  9 COG0777 AccD Acetyl-CoA carbox  29.1      39 0.00085   34.6   2.3   46   33-78     25-71  (294)
 10 PF14149 YhfH:  YhfH-like prote  26.3      15 0.00032   26.8  -0.9   14   35-48     12-25  (37)
 11 CHL00174 accD acetyl-CoA carbo  26.3      32  0.0007   35.3   1.2   46   33-78     35-81  (296)
 12 PRK05654 acetyl-CoA carboxylas  24.8      37  0.0008   34.6   1.3   46   33-78     24-70  (292)
 13 TIGR02098 MJ0042_CXXC MJ0042 f  24.3      38 0.00082   23.5   0.9   15   33-47     22-36  (38)
 14 COG1996 RPC10 DNA-directed RNA  24.2      41 0.00089   25.8   1.1   15   32-46     20-34  (49)
 15 TIGR00515 accD acetyl-CoA carb  21.5      42 0.00091   34.1   0.9   46   32-77     22-68  (285)
 16 cd00730 rubredoxin Rubredoxin;  21.4      75  0.0016   24.3   2.1   26   38-64      3-28  (50)
 17 PF07282 OrfB_Zn_ribbon:  Putat  21.0      76  0.0016   24.6   2.1   32   31-63     23-55  (69)

No 1  
>PF02365 NAM:  No apical meristem (NAM) protein;  InterPro: IPR003441 The NAC domain (for Petunia hybrida (Petunia) NAM and for Arabidopsis ATAF1, ATAF2, and CUC2) is an N-terminal module of ~160 amino acids, which is found in proteins of the NAC family of plant-specific transcriptional regulators (no apical meristem (NAM) proteins) []. NAC proteins are involved in developmental processes, including formation of the shoot apical meristem, floral organs and lateral shoots, as well as in plant hormonal control and defence. The NAC domain is accompanied by diverse C-terminal transcriptional activation domains. The NAC domain has been shown to be a DNA-binding domain (DBD) and a dimerization domain [,]. The NAC domain can be subdivided into five subdomains (A-E). Each subdomain is distinguishable by blocks of heterogeneous amino acids or gaps. While the NAC domains were rich in basic amino acids (R, K and H) as a whole, the distribution of positive and negative amino acids in each subdomain were unequal. Subdomains C and D are rich in basic amino acids but poor in acidic amino acids, while subdomain B contains a high proportion of acidic amino acids. Putative nuclear localization signals (NLS) have been detected in subdomains C and D []. The DBD is contained within a 60 amino acid region located within subdomains D and E []. The overall structure of the NAC domain monomer consists of a very twisted antiparallel beta-sheet, which packs against an N-terminal alpha-helix on one side and one shorter helix on the other side surrounded by a few helical elements. The structure suggests that the NAC domain mediates dimerization through conserved interactions including a salt bridge, and DNA binding through the NAC dimer face rich in positive charges [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1UT4_A 3SWM_B 4DUL_B 3SWP_D 1UT7_B 3ULX_A.
Probab=100.00  E-value=6.3e-39  Score=280.14  Aligned_cols=127  Identities=37%  Similarity=0.607  Sum_probs=90.3

Q ss_pred             CCCCceeCCChHHHHHHHHHhhhcCCCCCCCcccccccccccCCCCCCCCCCCCCC-CCCCCCceEEEEecccccCCCCc
Q 014310           58 LPRGVKFDPSDQEIIWHLLAKAGLEGLNPHPFIDEFIPTVDQDGGICYTHPQNLPG-VKQDGSAAHFFYRAIKAYSTGTR  136 (427)
Q Consensus        58 LPpGfRF~PTDeELI~hYL~kKi~G~~~p~Pli~~~Ip~vD~d~~Iy~~ePwdLPg-~~~dG~~wYFFs~r~kky~~G~R  136 (427)
                      |||||||+|||+|||.+||++|+.|.+.+   ...+|+++|    ||+.|||+||. ....++.||||+++.+++.+|.|
T Consensus         1 LP~G~rF~PtD~ELi~~yL~~k~~g~~~~---~~~~i~~~D----iy~~~P~~L~~~~~~~~~~~yFF~~~~~~~~~~~r   73 (129)
T PF02365_consen    1 LPPGFRFRPTDEELINHYLRPKILGEPLP---CEDVIHDVD----IYSAHPWELPAKFKGGDEEWYFFSPRKKKYPNGGR   73 (129)
T ss_dssp             --TTEEE---HHHHHHCTHHHHHTT-HHC---S-CHSEE------GGGS-GGGCHHHSSS-SSEEEEEEE----------
T ss_pred             CCCceEecCChHHHHHHHHHHHhcCCCCC---cccceeecc----cCccChHHhhhhccCCCceEEEEEecccccCCccc
Confidence            89999999999999999999999998532   126788887    99999999994 23456799999999999999999


Q ss_pred             cceeccCCCCCccEEeecCCCceeee-CCeeeEEEEEEEeeeeccCCCCCCCcCeEEEEEEeC
Q 014310          137 KRRKINGDDFGEVRWHKTGRTKPVML-DGVQKGCKKIMVLYMSMVRGGKAEKTNWVMHQYHLG  198 (427)
Q Consensus       137 ~rR~~~~G~~g~G~Wk~tGk~K~I~~-~G~vVG~KKtLvFY~gr~~g~kg~KT~WVMHEY~L~  198 (427)
                      ++|++.     +|+||.+|+.++|.. +|.+||+||+|+||.++.  +++.+|+|+||||+|.
T Consensus        74 ~~R~~~-----~G~Wk~~g~~~~i~~~~g~~iG~k~~l~f~~~~~--~~~~kt~W~M~EY~L~  129 (129)
T PF02365_consen   74 PNRVTG-----GGYWKSTGKEKPIKDPGGKVIGFKKTLVFYSGKS--PNGKKTGWVMHEYSLE  129 (129)
T ss_dssp             S-EEET-----TEEEEEECEEEEEEE-TTCEEEEEEEEEEEESST--TS-EEEEEEEEEEEE-
T ss_pred             cccccc-----ceEEeecccccccccccceeeeeEEEEEEEeccC--CCCCcCCeEEEEEEeC
Confidence            999774     479999999999998 899999999999997753  5778999999999984


No 2  
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=50.09  E-value=8.4  Score=30.54  Aligned_cols=15  Identities=40%  Similarity=0.862  Sum_probs=12.8

Q ss_pred             CCcccCCCCcceecC
Q 014310           34 NPTKACPNCHHVIDN   48 (427)
Q Consensus        34 ~~~~~cp~c~~~id~   48 (427)
                      +|++.||+||..|+-
T Consensus         1 e~HkHC~~CG~~Ip~   15 (59)
T PF09889_consen    1 EPHKHCPVCGKPIPP   15 (59)
T ss_pred             CCCCcCCcCCCcCCc
Confidence            478999999998865


No 3  
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=49.90  E-value=8.7  Score=25.18  Aligned_cols=12  Identities=50%  Similarity=0.955  Sum_probs=8.7

Q ss_pred             ccCCCCcceecC
Q 014310           37 KACPNCHHVIDN   48 (427)
Q Consensus        37 ~~cp~c~~~id~   48 (427)
                      +.||+|++.|+.
T Consensus         3 ~~Cp~Cg~~~~~   14 (26)
T PF13248_consen    3 MFCPNCGAEIDP   14 (26)
T ss_pred             CCCcccCCcCCc
Confidence            578888887654


No 4  
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=46.96  E-value=12  Score=26.20  Aligned_cols=16  Identities=38%  Similarity=0.794  Sum_probs=11.8

Q ss_pred             ccCCCcccCCCCccee
Q 014310           31 WKSNPTKACPNCHHVI   46 (427)
Q Consensus        31 ~~~~~~~~cp~c~~~i   46 (427)
                      ........||+|+|+|
T Consensus        12 ~~~~~~irC~~CG~RI   27 (32)
T PF03604_consen   12 LKPGDPIRCPECGHRI   27 (32)
T ss_dssp             BSTSSTSSBSSSS-SE
T ss_pred             cCCCCcEECCcCCCeE
Confidence            4556678999999987


No 5  
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=43.25  E-value=12  Score=24.11  Aligned_cols=13  Identities=38%  Similarity=0.953  Sum_probs=10.2

Q ss_pred             cCCCCcceecCCC
Q 014310           38 ACPNCHHVIDNSD   50 (427)
Q Consensus        38 ~cp~c~~~id~~~   50 (427)
                      .||+|++.|++..
T Consensus         1 ~Cp~CG~~~~~~~   13 (23)
T PF13240_consen    1 YCPNCGAEIEDDA   13 (23)
T ss_pred             CCcccCCCCCCcC
Confidence            4999999987643


No 6  
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=42.80  E-value=15  Score=27.30  Aligned_cols=16  Identities=31%  Similarity=0.430  Sum_probs=12.9

Q ss_pred             cCCCcccCCCCcceec
Q 014310           32 KSNPTKACPNCHHVID   47 (427)
Q Consensus        32 ~~~~~~~cp~c~~~id   47 (427)
                      +......||+|+|+|-
T Consensus        15 ~~~~~irC~~CG~rIl   30 (44)
T smart00659       15 KSKDVVRCRECGYRIL   30 (44)
T ss_pred             CCCCceECCCCCceEE
Confidence            3567789999999974


No 7  
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=32.65  E-value=20  Score=23.84  Aligned_cols=11  Identities=36%  Similarity=1.017  Sum_probs=8.0

Q ss_pred             ccCCCCcceec
Q 014310           37 KACPNCHHVID   47 (427)
Q Consensus        37 ~~cp~c~~~id   47 (427)
                      +.||+|+..|-
T Consensus         1 K~CP~C~~~V~   11 (26)
T PF10571_consen    1 KTCPECGAEVP   11 (26)
T ss_pred             CcCCCCcCCch
Confidence            46888888763


No 8  
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=30.11  E-value=21  Score=26.97  Aligned_cols=27  Identities=33%  Similarity=0.726  Sum_probs=18.2

Q ss_pred             cCCCCcceecCCCcCCCCCCCCCCceeC
Q 014310           38 ACPNCHHVIDNSDVAHEWPGLPRGVKFD   65 (427)
Q Consensus        38 ~cp~c~~~id~~~v~~~~~~LPpGfRF~   65 (427)
                      .|+.|+++-|-.. ....-++|||..|.
T Consensus         3 ~C~~CgyvYd~~~-Gd~~~~i~pGt~F~   29 (47)
T PF00301_consen    3 QCPVCGYVYDPEK-GDPENGIPPGTPFE   29 (47)
T ss_dssp             EETTTSBEEETTT-BBGGGTB-TT--GG
T ss_pred             CCCCCCEEEcCCc-CCcccCcCCCCCHH
Confidence            6999999988754 55556889998874


No 9  
>COG0777 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabolism]
Probab=29.07  E-value=39  Score=34.58  Aligned_cols=46  Identities=20%  Similarity=0.339  Sum_probs=39.3

Q ss_pred             CCCcccCCCCcceecCCCcCCCCCCCC-CCceeCCChHHHHHHHHHh
Q 014310           33 SNPTKACPNCHHVIDNSDVAHEWPGLP-RGVKFDPSDQEIIWHLLAK   78 (427)
Q Consensus        33 ~~~~~~cp~c~~~id~~~v~~~~~~LP-pGfRF~PTDeELI~hYL~k   78 (427)
                      .+-|..||.|++.|=..|+-....-.| -|+.|+=+-.|.|..+|-.
T Consensus        25 e~lw~KCp~c~~~~y~~eL~~n~~vcp~c~~h~ri~A~~Ri~~llD~   71 (294)
T COG0777          25 EGLWTKCPSCGEMLYRKELESNLKVCPKCGHHMRISARERLEALLDE   71 (294)
T ss_pred             CCceeECCCccceeeHHHHHhhhhcccccCcccccCHHHHHHHhhCC
Confidence            778999999999999999877666666 7999999999999987643


No 10 
>PF14149 YhfH:  YhfH-like protein
Probab=26.33  E-value=15  Score=26.75  Aligned_cols=14  Identities=36%  Similarity=0.937  Sum_probs=12.3

Q ss_pred             CcccCCCCcceecC
Q 014310           35 PTKACPNCHHVIDN   48 (427)
Q Consensus        35 ~~~~cp~c~~~id~   48 (427)
                      |.+.|+.||+.|+-
T Consensus        12 p~K~C~~CG~~i~E   25 (37)
T PF14149_consen   12 PPKKCTECGKEIEE   25 (37)
T ss_pred             CCcccHHHHHHHHH
Confidence            88999999999863


No 11 
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=26.29  E-value=32  Score=35.27  Aligned_cols=46  Identities=15%  Similarity=0.102  Sum_probs=36.9

Q ss_pred             CCCcccCCCCcceecCCCcCCCCCCCC-CCceeCCChHHHHHHHHHh
Q 014310           33 SNPTKACPNCHHVIDNSDVAHEWPGLP-RGVKFDPSDQEIIWHLLAK   78 (427)
Q Consensus        33 ~~~~~~cp~c~~~id~~~v~~~~~~LP-pGfRF~PTDeELI~hYL~k   78 (427)
                      .+.|..||+|++.|...++.....--| =|+.|.-|-.|-|..+|-+
T Consensus        35 ~~lw~kc~~C~~~~~~~~l~~~~~vcp~c~~h~rltAreRI~~L~D~   81 (296)
T CHL00174         35 KHLWVQCENCYGLNYKKFLKSKMNICEQCGYHLKMSSSDRIELLIDP   81 (296)
T ss_pred             CCCeeECCCccchhhHHHHHHcCCCCCCCCCCcCCCHHHHHHHHccC
Confidence            346899999999998888666555556 7999999999999986643


No 12 
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated
Probab=24.85  E-value=37  Score=34.60  Aligned_cols=46  Identities=22%  Similarity=0.337  Sum_probs=36.8

Q ss_pred             CCCcccCCCCcceecCCCcCCCCCCCC-CCceeCCChHHHHHHHHHh
Q 014310           33 SNPTKACPNCHHVIDNSDVAHEWPGLP-RGVKFDPSDQEIIWHLLAK   78 (427)
Q Consensus        33 ~~~~~~cp~c~~~id~~~v~~~~~~LP-pGfRF~PTDeELI~hYL~k   78 (427)
                      .+.|..||+|++.|-..++.....--| =|+.|.-|-.|-|..+|-+
T Consensus        24 ~~~~~~c~~c~~~~~~~~l~~~~~vc~~c~~h~rl~areRi~~L~D~   70 (292)
T PRK05654         24 EGLWTKCPSCGQVLYRKELEANLNVCPKCGHHMRISARERLDLLLDE   70 (292)
T ss_pred             CCCeeECCCccchhhHHHHHhcCCCCCCCCCCeeCCHHHHHHHHccC
Confidence            456999999999998888755544455 6899999999999987743


No 13 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=24.34  E-value=38  Score=23.51  Aligned_cols=15  Identities=27%  Similarity=0.514  Sum_probs=11.0

Q ss_pred             CCCcccCCCCcceec
Q 014310           33 SNPTKACPNCHHVID   47 (427)
Q Consensus        33 ~~~~~~cp~c~~~id   47 (427)
                      .+....||+|++.|.
T Consensus        22 ~~~~v~C~~C~~~~~   36 (38)
T TIGR02098        22 NGGKVRCGKCGHVWY   36 (38)
T ss_pred             CCCEEECCCCCCEEE
Confidence            345678999998864


No 14 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=24.23  E-value=41  Score=25.84  Aligned_cols=15  Identities=27%  Similarity=0.603  Sum_probs=12.3

Q ss_pred             cCCCcccCCCCccee
Q 014310           32 KSNPTKACPNCHHVI   46 (427)
Q Consensus        32 ~~~~~~~cp~c~~~i   46 (427)
                      .......||.|+|.|
T Consensus        20 ~~~~~irCp~Cg~rI   34 (49)
T COG1996          20 QETRGIRCPYCGSRI   34 (49)
T ss_pred             hccCceeCCCCCcEE
Confidence            345778999999997


No 15 
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=21.48  E-value=42  Score=34.13  Aligned_cols=46  Identities=20%  Similarity=0.311  Sum_probs=36.7

Q ss_pred             cCCCcccCCCCcceecCCCcCCCCCCCC-CCceeCCChHHHHHHHHH
Q 014310           32 KSNPTKACPNCHHVIDNSDVAHEWPGLP-RGVKFDPSDQEIIWHLLA   77 (427)
Q Consensus        32 ~~~~~~~cp~c~~~id~~~v~~~~~~LP-pGfRF~PTDeELI~hYL~   77 (427)
                      ..+.|..||+|+..|-..++.....--| =|+.|.-|--|-|..++-
T Consensus        22 ~~~~~~~c~~c~~~~~~~~l~~~~~vc~~c~~h~rl~areRi~~L~D   68 (285)
T TIGR00515        22 PEGVWTKCPKCGQVLYTKELERNLEVCPKCDHHMRMDARERIESLLD   68 (285)
T ss_pred             CCCCeeECCCCcchhhHHHHHhhCCCCCCCCCcCcCCHHHHHHHcee
Confidence            3456999999999998888655555556 799999999999987654


No 16 
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=21.43  E-value=75  Score=24.26  Aligned_cols=26  Identities=27%  Similarity=0.635  Sum_probs=19.9

Q ss_pred             cCCCCcceecCCCcCCCCCCCCCCcee
Q 014310           38 ACPNCHHVIDNSDVAHEWPGLPRGVKF   64 (427)
Q Consensus        38 ~cp~c~~~id~~~v~~~~~~LPpGfRF   64 (427)
                      .|..|+++.|-.. ....-++|||-.|
T Consensus         3 ~C~~CgyiYd~~~-Gd~~~~i~pGt~f   28 (50)
T cd00730           3 ECRICGYIYDPAE-GDPDEGIPPGTPF   28 (50)
T ss_pred             CCCCCCeEECCCC-CCcccCcCCCCCH
Confidence            6999999998643 4455678888877


No 17 
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=20.98  E-value=76  Score=24.63  Aligned_cols=32  Identities=19%  Similarity=0.350  Sum_probs=19.5

Q ss_pred             ccCCCcccCCCCcceecCCCcCCCCCCCC-CCce
Q 014310           31 WKSNPTKACPNCHHVIDNSDVAHEWPGLP-RGVK   63 (427)
Q Consensus        31 ~~~~~~~~cp~c~~~id~~~v~~~~~~LP-pGfR   63 (427)
                      ....+.+.||.|++.... ........-| =|+.
T Consensus        23 ~~~~TSq~C~~CG~~~~~-~~~~r~~~C~~Cg~~   55 (69)
T PF07282_consen   23 DEAYTSQTCPRCGHRNKK-RRSGRVFTCPNCGFE   55 (69)
T ss_pred             CCCCCccCccCccccccc-ccccceEEcCCCCCE
Confidence            345578899999998766 3333344444 4554


Done!