Citrus Sinensis ID: 014311

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------

MHTHRLSTPNHNLHQLGLSPCRIFYPTSSPTLAFNQNSTFGFCNSLKRLAKSLTSTRKCRGGYRIRCGQVQNNDKDDGFYMRRCVELATKAVGSTSPNPMVGCVIVKDGKIVGEGFHPKAGQPHAEVFALRDAGELAEGATAYVSLEPCNHYGRTPPCTEALIKAKVKKVVVGMLDPNPIVNSKGLERLRDAGIDVTVGVEDELCKRLNEAFIHRIVTGKPFATLRYTLSVNGHVLDQLGEGVAESGGYYSQLLQEYDAIILSASSTKKYSIPASQEPDANQPFRIITVSNHASPIRIPGLSEESSSKVIVFTDGEITVEPDMGTKGIETVNLHQLNLKAVLDYCYSHGFCSVLVDLRGNYGDLEMLLKEGIEQNLLQKIVVEVLPVWNGSDGGNPHTLLNSLGKRLILKNLQPKMSSQSIVLEGYL

cccccccccccccccccccccEEEcccccccccccccccccccHHHHccHHHccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccEEEEEccEEEECccccccccccHHHHHHHHHcccccccEEEEEcccccccccccHHHHHHHHccccEEEEEccccccccccHHHHHHHHcccEEEEccHHHHHHHHHHHHHHHHHccccEEEEEHHcccccccccccccccccccHHHHHHHHHccEEEEccccEECcccccccccccccccEEEEEccccccccccccccccccEEEEEEcccccccccccccccEEEEcccccHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHcccccEEEEEEccccccccccccccccccHHcccccccccEEECcccEEEEEEc

*********NHNLHQLGLSPCRIFYPTSSPTLAFNQNSTFGFCNSLKRLAKSLTSTRKCRGGYRIRCGQVQNNDKDDGFYMRRCVELATKAVGSTSPNPMVGCVIVKDGKIVGEGFHPKAGQPHAEVFALRDAGELAEGATAYVSLEPCNHYGRTPPCTEALIKAKVKKVVVGMLDPNPIVNSKGLERLRDAGIDVTVGVEDELCKRLNEAFIHRIVTGKPFATLRYTLSVNGHVLDQLGEGVAESGGYYSQLLQEYDAIILSASSTKKYSIPASQEPDANQPFRIITVSNHASPIRIPGLSEESSSKVIVFTDGEITVEPDMGTKGIETVNLHQLNLKAVLDYCYSHGFCSVLVDLRGNYGDLEMLLKEGIEQNLLQKIVVEVLPVWNGSDGGNPHTLLNSLGKRLILKNLQPKMSSQSIVLEGYL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
1.-.-.-	Oxidoreductases.	probable
3.-.-.-	Hydrolases.	probable
3.5.-.-	Acting on carbon-nitrogen bonds, other than peptide bonds.	probable
1.1.-.-	Acting on the CH-OH group of donors.	probable
1.1.1.-	15-hydroxyprostaglandin dehydrogenase (NAD(+)).	probable
3.5.4.-	4'-demethylrebeccamycin synthase.	probable
3.5.4.26	Diaminohydroxyphosphoribosylaminopyrimidine deaminase.	probable
1.1.1.193	5-amino-6-(5-phosphoribosylamino)uracil reductase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2B3Z, chain A
Confidence level:very confident
Coverage over the Query: 76-426
View the alignment between query and template
View the model in PyMOL