Citrus Sinensis ID: 014352

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420------

MVHKSDLVIIGICVGLALGILIATLVFFGLRWYKKHDHLRRCSNERSVATHPIRINGLGTSIDFSAPVANSVAVKASGFPQKKSQVSWWSNHSKDRFTSAPSASGIPRYAYKDIQKATQNFTNILGQGAFGPVYKATMPSGGVAAIKVLASDSHQGEKEFQTEVSLLGRLHHRNLVNLIGYCVDKGKYMLIYEFMSNGSLSNLIYSEERVLNWEERLQIALDISHGIEYLHEGAVPPVIHRDLKSANILLDHFMRAKVADFGLSKEEVFDGRNSGLKGTYGYIDPAYISTNKFTMKSDIFSFGVIIFELITAIHPHQNLMEYVNLASMSQDGVDEILDKQLVGACNIQEVRELARIGHKCLHKTPRKRPSIGEVTQALLKIKQRHLAKQDTMSFADGEFSRAVSRIEDQQVELSKLAEVKERHEEC

ccccccEEEEHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccCECcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccEEEEcccccEEEEEEccccccccHHHHHHHHHHHHHcccccccccEEEEccccEEEEEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccHHHHHHHHHHHcccccccHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHcccHHHHHHHccc

****SDLVIIGICVGLALGILIATLVFFGLRWYKKH*********************************************************************IPRYAYKDIQKATQNFTNILGQGAFGPVYKATMPSGGVAAIKVLAS*******EFQTEVSLLGRLHHRNLVNLIGYCVDKGKYMLIYEFMSNGSLSNLIYSEERVLNWEERLQIALDISHGIEYLHEGAVPPVIHRDLKSANILLDHFMRAKVADFGLSKEEVFDGRNSGLKGTYGYIDPAYISTNKFTMKSDIFSFGVIIFELITAIHPHQNLMEYVNLASMSQDGVDEILDKQLVGACNIQEVRELARIGHKCLHKTPRKRPSIGEVTQALLKIK********************************************

xxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable leucine-rich repeat receptor-like serine/threonine-protein kinase At5g15730		probable	Q9LFV3

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UIM, chain A
Confidence level:very confident
Coverage over the Query: 106-380
View the alignment between query and template
View the model in PyMOL

Template: 3KMM, chain A
Confidence level:confident
Coverage over the Query: 86-94,106-378,389-395
View the alignment between query and template
View the model in PyMOL

Template: 3LM0, chain A
Confidence level:probable
Coverage over the Query: 116-339,350-397
View the alignment between query and template
View the model in PyMOL

Template: 2L2T, chain A
Confidence level:probable
Coverage over the Query: 5-36
View the alignment between query and template
View the model in PyMOL