Citrus Sinensis ID: 014372

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420------

MGKGLIPADLDTWKQRRRVIAPGFHALYLEAMVNMFADCSERTIMKFEKLLEGEDSRGGNSIELDLEAEFSSLALDIIGLGVFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFYIPYWKIPLARWIVPRQRKFQNDLKIINDCLDGLIRNAKETRQETDVEKLQSRDYSNLKDASLLRFLVDMRGADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSKVKKAQAEVDSVLGQKKPTFESLKKLEYIRLIVAESLRLYPQPPLLIRRTIKPDVLPGGYRGDKDGYPVPAGTDIFLSIYNLHRSPYFWDRPHEFEPERFLKPRKDVGIEGWSGFDPSRSPGALYPNEIVSDYAFLGFGGGPRKCVGDQFAVMESTVGLAMLLQKFDIELKGSPESVELVTGATIHTKNGLWCKLRERSAVH

ccccccccccccHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHccccccccHHHHHHHHHcccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccHHHccccHHHHHHHHHHccccccccccEEEccccEEcccccccccccEEEccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccCCccccccccccHHHHHHHHHHHHHHHHHHccEEEcccccccccccccEEEEccccEEEEEECccccc

MGKGLIPADLDTWKQRRRVIAPGFHALYLEAMVNMFADCSERTIMKFEKLLEG****GGNSIELDLEAEFSSLALDIIGLGVFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFYIPYWKIPLARWIVPRQRKFQNDLKIINDCLDGLIRN********************LKDASLLRFLVDMRGADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSKVKKAQAEVDSVLGQKKPTFESLKKLEYIRLIVAESLRLYPQPPLLIRRTIKPDVLPGGYRGDKDGYPVPAGTDIFLSIYNLHRSPYFWDRPHEFEPERFLKPRKDVGIEGWSGFDPSR*PGALYPNEIVSDYAFLGFGGGPRKCVGDQFAVMESTVGLAMLLQKFDIELKGSPESVELVTGATIHTKNGLWCKLRERS***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Cytochrome P450 97B2, chloroplastic		probable	O48921
Cytochrome P450 97B3, chloroplastic	Heme-containing cytochrome P450 probably involved in the biosynthesis of xanthophylls. Hydroxylates beta-rings of alpha-carotene. May also have activity on beta-rings of beta-carotene.	probable	O23365
Cytochrome P450 97B1, chloroplastic		probable	Q43078

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CZH, chain A
Confidence level:very confident
Coverage over the Query: 3-158,172-330,353-423
View the alignment between query and template
View the model in PyMOL

Template: 3DAX, chain A
Confidence level:very confident
Coverage over the Query: 2-45,60-154,166-334,348-425
View the alignment between query and template
View the model in PyMOL

Template: 3RUK, chain A
Confidence level:confident
Coverage over the Query: 3-344,359-412
View the alignment between query and template
View the model in PyMOL