Citrus Sinensis ID: 014376

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420------

MSTPMEITVHNSTEAEISDQDGIPEQKGVAGPPLPLLAEDKFLVSVEVCLKLSSTARIDDVRLAVERMLEKRSLSYVDGPIPIPIDDPFLVENVQRICVSDTDEWVKNHDILLFWQVKPVVQVFQLSEEGPCEELSGDGQLSSFNEWILPAKEFDGMWESLIYESGLKQRLLHYAASALMFAEKGVNPFLVSWNRIVLLHGPPGTGKTSLCKALAQKLSIRFSSRYPQCQLVEVNAHSLFSKWFSESGKLVAKLFQKIQEMVEEENNLVFVLIDEVESLAAARKAALSGSEPSDSIRVVNALLTQMDKLKSSPNVIILTTSNITAAIDIAFVDRADIKAYVGPPTLQARYEILRSCLQELIRTGIISNFQDCDQSMLPNFSILKEKLSNPDIQEADRSQHFYKQLLEAAEACEVRNKMFHLILAFV

ccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEccccccHHHHHHHHHHHHHHcccccccccccccccccHHHHHHccEEEECccccccccccHHcccccccEEEEEccccccccccccccccccccEEEEcccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccEEEEEccccccHHHHHHHHHHHHcccccccccccEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHcccEEEEEEEcccccHHHHHcccccccccHHHHHHHHHHHHHccccccccEEEEEEcccccccHHHHHcccccEEECccccHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcHHcHHHHHHHHccc

*********************************LPLLAEDKFLVSVEVCLKLSSTARIDDVRLAVERMLEKRSLSYVDGPIPIPIDDPFLVENVQRICVSDTDEWVKNHDILLFWQVKPVVQVFQLSEEGPCEELSGDGQLSSFNEWILPAKEFDGMWESLIYESGLKQRLLHYAASALMFAEKGVNPFLVSWNRIVLLHGPPGTGKTSLCKALAQKLSIRFSSRYPQCQLVEVNAHSLFSKWFSESGKLVAKLFQKIQEMVEEENNLVFVLIDEVESLA***************IRVVNALLTQMDKLKSSPNVIILTTSNITAAIDIAFVDRADIKAYVGPPTLQARYEILRSCLQELIRTGIISNFQDCDQSMLPNFSILKEKLSNPDIQEADRSQHFYKQLLEAAEACEVRNKMFHLILAFV

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Pachytene checkpoint protein 2 homolog	Plays a key role in chromosome recombination during meiosis.	confident	Q8H1F9
Pachytene checkpoint protein 2 homolog	Plays a key role in chromosome recombination during meiosis.	probable	Q7XK25
Pachytene checkpoint protein 2 homolog	Plays a key role in chromosome recombination and chromosome structure development during meiosis. Required at early steps in meiotic recombination that leads to non-crossovers pathways. Also needed for efficient completion of homologous synapsis by influencing crossover distribution along the chromosomes affecting both crossovers and non-crossovers pathways.	probable	E1C6Q1

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4B4T, chain M
Confidence level:very confident
Coverage over the Query: 151-398
View the alignment between query and template
View the model in PyMOL

Template: 2ZAN, chain A
Confidence level:very confident
Coverage over the Query: 154-409
View the alignment between query and template
View the model in PyMOL