Citrus Sinensis ID: 014391

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-----

MSFRSIVRDVRDSFGSLSRRSFDFRLTGHHGGKSHGSSNDLHDQNIVIQNSCWASLPPELLCDVIKRLEESESSWPARKHVVACAAVCRSWRAMCKEIVRSPEFCGKLTFPVSLKQPGARDGTIQCFIKRDKSNLTYHLFLCLSPALLVENGKFLLSAKRTRRTTCTEYVISMDADNISRSSSTYIGKLRSNFLGTKFIIYDTQPPHTSANITPSGCTSRRFYSKKVSPKVPSGSYNIAQIAYELNVLGTRGPRRMHCIMHSIPASSIDVGGSVPGQPELLPRSLEDSFRSISFSKSLDHSVDFSSARFSEIGALREDDEDGKLRPLILKNKPPRWHEQLQCWCLNFRGRVTVASVKNFQLIAATQPAAGAPTPSQPAPPEHDKIILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTKLACE

cccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccEEEEccccHHHHHHHHHHHcccccccccccccccccccccccEEEEEEEECccccccccccccccccccccccEEEEEEEccccccEEEEEEccccccccccccEEEEEEEcccccEEEEEccccccccccccccccccccccccccccccccccccEEEEEEEcccccccccccEEEEECcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccEEEccccEEEEEEEccEEEECcccccccccccccccccccccEEEEEEcccccEEEEEEcccccHHHHHHHHHHHcccccccc

**********RD********************************N*VIQNSCWASLPPELLCDVIKRLEESESSWPARKHVVACAAVCRSWRAMCKEIVRSPEFCGKLTFPVSLKQPGARDGTIQCFIKRDKSNLTYHLFLCLSPALLVENGKFLLSAKRTRRTTCTEYVISMDADNISRSSSTYIGKLRSNFLGTKFIIYDTQPP**************************SGSYNIAQIAYELNVLGTRGPRRMHCIMHSIPA*********************************************************KLRPLILKNKPPRWHEQLQCWCLNFRGRVTVASVKNFQLIAA****************EHDKIILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTKLACE

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Tubby-like F-box protein 8		confident	Q75HX5
Tubby-like F-box protein 10	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.	confident	Q9FRH7
Tubby-like F-box protein 13		probable	Q53PP5

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2FIM, chain A
Confidence level:very confident
Coverage over the Query: 113-210,227-290,302-364,380-419
View the alignment between query and template
View the model in PyMOL

Template: 1C8Z, chain A
Confidence level:confident
Coverage over the Query: 116-221,238-303,329-365,381-425
View the alignment between query and template
View the model in PyMOL

Template: 1FS1, chain A
Confidence level:confident
Coverage over the Query: 53-96
View the alignment between query and template
View the model in PyMOL