Citrus Sinensis ID: 014393


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-----
MTNSERKRLNGEAEEEEEDEDDNLNGGLEAWERSYADDRSWEALQEDESGFLRPIDNSAFYHAQYRRRLRDRSLVATTARIQKGLIRYLYIVIDLSRAAAEMDFRPSRMAVVAKQVEAFVREFFDQNPLSQIGLVTVKDGVANCLTDLGGSPESHIKALMGKLGCSGDSSLQNALDLVQGLLSQIPSYGHREVLILYSALSTCDPGDIMETIQKCKESKIRCSVIGLSAEMFICKHLCQDTGGSYSVALDESHFKELIMEHAPPPPAIAEFAIANLIKMGFPQRAGEGSISICSCHKEVKVGVGYTCPRCKARVCELPTDCRICGLQLVSSPHLARSYHHLFPIAPFDEVTPLCLNDPRNRSRSTCFGCQQSLLSSGNKPGLYVACPKCKKHFCLECDIYIHESLHNCPGCESLRHSNPIVANEG
ccccccccccccccccccccccccccccccccccccccccccEECcccccccccccHHHHHHHHHHHHHHHccccccHHHHHcccEEEEEEEEEccHHHHcccccccHHHHHHHHHHHHHHHHHcccccccEEEEEEcccEEEEEEcccccHHHHHHHHHccccccccccHHHHHHHHHHHHcccccccccEEEEEEccccccccccHHHHHHHHHHccEEEEEEEccccHHHHHHHHccccccEEEEccHHHHHHHHHHccccccHHHHHcccccEECcccccccccccccEEcccccccccCEEccccccccccccccccccccEEEcccHHHHHcccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccHHHHHcccccccccccccccccccccc
*******************************ERSYADDRSWEALQEDESGFLRPIDNSAFYHAQYRRRLRDRSLVATTARIQKGLIRYLYIVIDLSRAAAEMDFRPSRMAVVAKQVEAFVREFFDQNPLSQIGLVTVKDGVANCLTDLGGSPESHIKALMGKLGCSGDSSLQNALDLVQGLLSQIPSYGHREVLILYSALSTCDPGDIMETIQKCKESKIRCSVIGLSAEMFICKHLCQDTGGSYSVALDESHFKELIMEHAPPPPAIAEFAIANLIKMGFPQRAGEGSISICSCHKEVKVGVGYTCPRCKARVCELPTDCRICGLQLVSSPHLARSYHHLFPIAPFDEVTPLCLNDPRNRSRSTCFGCQQSLLSSGNKPGLYVACPKCKKHFCLECDIYIHESLHNCPGCESLR**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTNSERKRLNGEAEEEEEDEDDNLNGGLEAWERSYADDRSWEALQEDESGFLRPIDNSAFYHAQYRRRLRDRSLVATTARIQKGLIRYLYIVIDLSRAAAEMDFRPSRMAVVAKQVEAFVREFFDQNPLSQIGLVTVKDGVANCLTDLGGSPESHIKALMGKLGCSGDSSLQNALDLVQGLLSQIPSYGHREVLILYSALSTCDPGDIMETIQKCKESKIRCSVIGLSAEMFICKHLCQDTGGSYSVALDESHFKELIMEHAPPPPAIAEFAIANLIKMGFPQRAGEGSISICSCHKEVKVGVGYTCPRCKARVCELPTDCRICGLQLVSSPHLARSYHHLFPIAPFDEVTPLCLNDPRNRSRSTCFGCQQSLLSSGNKPGLYVACPKCKKHFCLECDIYIHESLHNCPGCESLRHSNPIVANEG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
General transcription factor IIH subunit 2 Component of the core-TFIIH basal transcription factor involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II.probableP34567
General transcription factor IIH subunit 2 Component of the core-TFIIH basal transcription factor involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II.probableQ86KZ2
General transcription factor IIH subunit 2 Component of the core-TFIIH basal transcription factor involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. The N-terminus interacts with and regulates XPD whereas an intact C-terminus is required for a successful escape of RNAP II form the promoter.probableQ9JIB4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1Z60, chain A
Confidence level:very confident
Coverage over the Query: 344-412
View the alignment between query and template
View the model in PyMOL
Template: 2X5N, chain A
Confidence level:confident
Coverage over the Query: 86-259
View the alignment between query and template
View the model in PyMOL
Template: 2I13, chain A
Confidence level:probable
Coverage over the Query: 304-344,362-413
View the alignment between query and template
View the model in PyMOL