BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 014413
         (425 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1QG8|A Chain A, Native (Magnesium-Containing) Spsa From Bacillus Subtilis
 pdb|1QGQ|A Chain A, Udp-manganese Complex Of Spsa From Bacillus Subtilis
 pdb|1QGS|A Chain A, Udp-Magnesium Complex Of Spsa From Bacillus Subtilis
 pdb|1H7L|A Chain A, Dtdp-Magnesium Complex Of Spsa From Bacillus Subtilis
 pdb|1H7Q|A Chain A, Dtdp-Manganese Complex Of Spsa From Bacillus Subtilis
          Length = 255

 Score = 31.6 bits (70), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 118 LTNQAIIEAMEGEKVVHVIDLNAAEPAQWIALIQALSTRPE 158
           L NQAI E  EGE + +  D N   P + + +++ L T PE
Sbjct: 79  LINQAI-EMAEGEYITYATDDNIYMPDRLLKMVRELDTHPE 118


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.321    0.134    0.397 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,415,246
Number of Sequences: 62578
Number of extensions: 413190
Number of successful extensions: 841
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 840
Number of HSP's gapped (non-prelim): 6
length of query: 425
length of database: 14,973,337
effective HSP length: 102
effective length of query: 323
effective length of database: 8,590,381
effective search space: 2774693063
effective search space used: 2774693063
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 53 (25.0 bits)