BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 014423
         (425 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1N10|A Chain A, Crystal Structure Of Phl P 1, A Major Timothy Grass Pollen
           Allergen
 pdb|1N10|B Chain B, Crystal Structure Of Phl P 1, A Major Timothy Grass Pollen
           Allergen
          Length = 241

 Score = 28.1 bits (61), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 32/66 (48%), Gaps = 6/66 (9%)

Query: 295 KGVKPTYLCAIAEMVSMRFVNGVSPRIGLMGIDYSTAFWIYMELGYRA-YKVDSADDLTK 353
           KG  P YL  +     +++VNG    + +   +     WI ++  + A +++D+ D LT 
Sbjct: 154 KGSNPNYLALL-----VKYVNGDGDVVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTG 208

Query: 354 PFVSMY 359
           PF   Y
Sbjct: 209 PFTVRY 214


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.318    0.133    0.401 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 12,735,625
Number of Sequences: 62578
Number of extensions: 513548
Number of successful extensions: 1226
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 1226
Number of HSP's gapped (non-prelim): 5
length of query: 425
length of database: 14,973,337
effective HSP length: 102
effective length of query: 323
effective length of database: 8,590,381
effective search space: 2774693063
effective search space used: 2774693063
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)