Query         014445
Match_columns 424
No_of_seqs    186 out of 941
Neff          4.6 
Searched_HMMs 46136
Date          Fri Mar 29 05:11:43 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/014445.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/014445hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02365 NAM:  No apical merist 100.0 1.4E-38 3.1E-43  277.6   5.6  127   58-198     1-129 (129)
  2 PF09889 DUF2116:  Uncharacteri  49.5     9.3  0.0002   30.3   1.3   17   34-50      1-17  (59)
  3 PF13248 zf-ribbon_3:  zinc-rib  44.4      13 0.00028   24.3   1.2   13   37-49      3-15  (26)
  4 PF13240 zinc_ribbon_2:  zinc-r  37.2      19 0.00041   23.2   1.0   13   38-50      1-13  (23)
  5 PF03604 DNA_RNApol_7kD:  DNA d  36.2      22 0.00048   24.8   1.3   16   31-46     12-27  (32)
  6 smart00659 RPOLCX RNA polymera  29.7      29 0.00064   25.7   1.2   16   32-47     15-30  (44)
  7 PF00301 Rubredoxin:  Rubredoxi  29.4      19 0.00041   27.2   0.1   27   38-65      3-29  (47)
  8 PF10571 UPF0547:  Uncharacteri  27.9      31 0.00068   22.9   0.9   11   35-45     13-23  (26)
  9 PF07282 OrfB_Zn_ribbon:  Putat  23.1      68  0.0015   24.9   2.2   33   30-63     22-55  (69)
 10 COG0777 AccD Acetyl-CoA carbox  22.9      55  0.0012   33.5   2.0   46   33-78     25-71  (294)
 11 cd00730 rubredoxin Rubredoxin;  22.5      64  0.0014   24.6   1.9   26   38-64      3-28  (50)
 12 CHL00174 accD acetyl-CoA carbo  21.4      47   0.001   34.1   1.3   46   33-78     35-81  (296)

No 1  
>PF02365 NAM:  No apical meristem (NAM) protein;  InterPro: IPR003441 The NAC domain (for Petunia hybrida (Petunia) NAM and for Arabidopsis ATAF1, ATAF2, and CUC2) is an N-terminal module of ~160 amino acids, which is found in proteins of the NAC family of plant-specific transcriptional regulators (no apical meristem (NAM) proteins) []. NAC proteins are involved in developmental processes, including formation of the shoot apical meristem, floral organs and lateral shoots, as well as in plant hormonal control and defence. The NAC domain is accompanied by diverse C-terminal transcriptional activation domains. The NAC domain has been shown to be a DNA-binding domain (DBD) and a dimerization domain [,]. The NAC domain can be subdivided into five subdomains (A-E). Each subdomain is distinguishable by blocks of heterogeneous amino acids or gaps. While the NAC domains were rich in basic amino acids (R, K and H) as a whole, the distribution of positive and negative amino acids in each subdomain were unequal. Subdomains C and D are rich in basic amino acids but poor in acidic amino acids, while subdomain B contains a high proportion of acidic amino acids. Putative nuclear localization signals (NLS) have been detected in subdomains C and D []. The DBD is contained within a 60 amino acid region located within subdomains D and E []. The overall structure of the NAC domain monomer consists of a very twisted antiparallel beta-sheet, which packs against an N-terminal alpha-helix on one side and one shorter helix on the other side surrounded by a few helical elements. The structure suggests that the NAC domain mediates dimerization through conserved interactions including a salt bridge, and DNA binding through the NAC dimer face rich in positive charges [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1UT4_A 3SWM_B 4DUL_B 3SWP_D 1UT7_B 3ULX_A.
Probab=100.00  E-value=1.4e-38  Score=277.57  Aligned_cols=127  Identities=37%  Similarity=0.607  Sum_probs=90.2

Q ss_pred             CCCCceeCCChHHHHHHHHHhhhcCCCCCCCccccccceeccCCCCCCCCCCCCCC-CCCCCCceEEEeccccccCCCCc
Q 014445           58 LPRGVKFDPSDQEIIWHLLAKAGLEGLNPHPFIDEFIPTVDQDGGICYTHPQNLPG-VKQDGSAAHFFYRAIKAYSTGTR  136 (424)
Q Consensus        58 LPpGfRF~PTDeELI~~YL~kKi~G~~~p~Pli~~~Ip~vD~d~~Iy~~ePwdLPg-~~~dG~~wYFFs~r~kky~~G~R  136 (424)
                      |||||||+|||+|||.+||++|+.|.+.+   ...+|.++|    ||+.|||+||. ....++.||||+++.+++.+|.|
T Consensus         1 LP~G~rF~PtD~ELi~~yL~~k~~g~~~~---~~~~i~~~D----iy~~~P~~L~~~~~~~~~~~yFF~~~~~~~~~~~r   73 (129)
T PF02365_consen    1 LPPGFRFRPTDEELINHYLRPKILGEPLP---CEDVIHDVD----IYSAHPWELPAKFKGGDEEWYFFSPRKKKYPNGGR   73 (129)
T ss_dssp             --TTEEE---HHHHHHCTHHHHHTT-HHC---S-CHSEE------GGGS-GGGCHHHSSS-SSEEEEEEE----------
T ss_pred             CCCceEecCChHHHHHHHHHHHhcCCCCC---cccceeecc----cCccChHHhhhhccCCCceEEEEEecccccCCccc
Confidence            89999999999999999999999998532   126788887    99999999994 23456799999999999999999


Q ss_pred             ccccccCCCCCccEEeecCCCceEec-CCeeeeeEEEEEeeeeccCCCCCCCcCeEEEEEEeC
Q 014445          137 KRRKINGDDFGEVRWHKTGRTKPVML-DGVQKGCKKIMVLYMSMVRGGKAEKTNWVMHQYHLG  198 (424)
Q Consensus       137 ~~R~t~~G~~g~G~Wk~tGk~K~I~~-~G~vVG~KKtLvFY~gr~~g~kg~KT~WVMHEY~L~  198 (424)
                      ++|+++     +|+||.+|+.++|.. +|.+||+||+|+||.++.  +++.+|+|+||||+|.
T Consensus        74 ~~R~~~-----~G~Wk~~g~~~~i~~~~g~~iG~k~~l~f~~~~~--~~~~kt~W~M~EY~L~  129 (129)
T PF02365_consen   74 PNRVTG-----GGYWKSTGKEKPIKDPGGKVIGFKKTLVFYSGKS--PNGKKTGWVMHEYSLE  129 (129)
T ss_dssp             S-EEET-----TEEEEEECEEEEEEE-TTCEEEEEEEEEEEESST--TS-EEEEEEEEEEEE-
T ss_pred             cccccc-----ceEEeecccccccccccceeeeeEEEEEEEeccC--CCCCcCCeEEEEEEeC
Confidence            999764     479999999999998 899999999999997753  4778999999999984


No 2  
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=49.51  E-value=9.3  Score=30.26  Aligned_cols=17  Identities=35%  Similarity=0.823  Sum_probs=14.1

Q ss_pred             CCCccCCCCCccccCCC
Q 014445           34 NPTKACPNCHHVIDNSD   50 (424)
Q Consensus        34 ~~~~~c~~c~~~id~s~   50 (424)
                      .+++.||+||..|+.+.
T Consensus         1 e~HkHC~~CG~~Ip~~~   17 (59)
T PF09889_consen    1 EPHKHCPVCGKPIPPDE   17 (59)
T ss_pred             CCCCcCCcCCCcCCcch
Confidence            37899999999988643


No 3  
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=44.41  E-value=13  Score=24.34  Aligned_cols=13  Identities=46%  Similarity=0.894  Sum_probs=9.3

Q ss_pred             ccCCCCCccccCC
Q 014445           37 KACPNCHHVIDNS   49 (424)
Q Consensus        37 ~~c~~c~~~id~s   49 (424)
                      +.||+|++.|+.+
T Consensus         3 ~~Cp~Cg~~~~~~   15 (26)
T PF13248_consen    3 MFCPNCGAEIDPD   15 (26)
T ss_pred             CCCcccCCcCCcc
Confidence            5788888876543


No 4  
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=37.19  E-value=19  Score=23.21  Aligned_cols=13  Identities=38%  Similarity=0.953  Sum_probs=10.3

Q ss_pred             cCCCCCccccCCC
Q 014445           38 ACPNCHHVIDNSD   50 (424)
Q Consensus        38 ~c~~c~~~id~s~   50 (424)
                      .||+|++.|++..
T Consensus         1 ~Cp~CG~~~~~~~   13 (23)
T PF13240_consen    1 YCPNCGAEIEDDA   13 (23)
T ss_pred             CCcccCCCCCCcC
Confidence            4999999987643


No 5  
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=36.21  E-value=22  Score=24.83  Aligned_cols=16  Identities=38%  Similarity=0.794  Sum_probs=11.8

Q ss_pred             ccCCCCccCCCCCccc
Q 014445           31 WKSNPTKACPNCHHVI   46 (424)
Q Consensus        31 ~~~~~~~~c~~c~~~i   46 (424)
                      ...+....|++|+|+|
T Consensus        12 ~~~~~~irC~~CG~RI   27 (32)
T PF03604_consen   12 LKPGDPIRCPECGHRI   27 (32)
T ss_dssp             BSTSSTSSBSSSS-SE
T ss_pred             cCCCCcEECCcCCCeE
Confidence            4556678999999986


No 6  
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=29.75  E-value=29  Score=25.71  Aligned_cols=16  Identities=31%  Similarity=0.430  Sum_probs=12.8

Q ss_pred             cCCCCccCCCCCcccc
Q 014445           32 KSNPTKACPNCHHVID   47 (424)
Q Consensus        32 ~~~~~~~c~~c~~~id   47 (424)
                      +......||+|+|.|-
T Consensus        15 ~~~~~irC~~CG~rIl   30 (44)
T smart00659       15 KSKDVVRCRECGYRIL   30 (44)
T ss_pred             CCCCceECCCCCceEE
Confidence            3567789999999973


No 7  
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=29.40  E-value=19  Score=27.17  Aligned_cols=27  Identities=33%  Similarity=0.726  Sum_probs=18.5

Q ss_pred             cCCCCCccccCCCcCCCCCCCCCCceeC
Q 014445           38 ACPNCHHVIDNSDVAHEWPGLPRGVKFD   65 (424)
Q Consensus        38 ~c~~c~~~id~s~v~~~~~~LPpGfRF~   65 (424)
                      .|+.|+++-|... .-..-++|||..|.
T Consensus         3 ~C~~CgyvYd~~~-Gd~~~~i~pGt~F~   29 (47)
T PF00301_consen    3 QCPVCGYVYDPEK-GDPENGIPPGTPFE   29 (47)
T ss_dssp             EETTTSBEEETTT-BBGGGTB-TT--GG
T ss_pred             CCCCCCEEEcCCc-CCcccCcCCCCCHH
Confidence            6999999998865 44556889998874


No 8  
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=27.89  E-value=31  Score=22.94  Aligned_cols=11  Identities=36%  Similarity=0.824  Sum_probs=5.9

Q ss_pred             CCccCCCCCcc
Q 014445           35 PTKACPNCHHV   45 (424)
Q Consensus        35 ~~~~c~~c~~~   45 (424)
                      ..+.||.|||.
T Consensus        13 ~~~~Cp~CG~~   23 (26)
T PF10571_consen   13 SAKFCPHCGYD   23 (26)
T ss_pred             hcCcCCCCCCC
Confidence            44555555554


No 9  
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=23.12  E-value=68  Score=24.90  Aligned_cols=33  Identities=18%  Similarity=0.323  Sum_probs=20.6

Q ss_pred             cccCCCCccCCCCCccccCCCcCCCCCCCC-CCce
Q 014445           30 KWKSNPTKACPNCHHVIDNSDVAHEWPGLP-RGVK   63 (424)
Q Consensus        30 ~~~~~~~~~c~~c~~~id~s~v~~~~~~LP-pGfR   63 (424)
                      +....+++.||.|++.... ........-| =|+.
T Consensus        22 v~~~~TSq~C~~CG~~~~~-~~~~r~~~C~~Cg~~   55 (69)
T PF07282_consen   22 VDEAYTSQTCPRCGHRNKK-RRSGRVFTCPNCGFE   55 (69)
T ss_pred             ECCCCCccCccCccccccc-ccccceEEcCCCCCE
Confidence            3355588999999999766 3333344444 4554


No 10 
>COG0777 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabolism]
Probab=22.90  E-value=55  Score=33.53  Aligned_cols=46  Identities=20%  Similarity=0.339  Sum_probs=39.1

Q ss_pred             CCCCccCCCCCccccCCCcCCCCCCCC-CCceeCCChHHHHHHHHHh
Q 014445           33 SNPTKACPNCHHVIDNSDVAHEWPGLP-RGVKFDPSDQEIIWHLLAK   78 (424)
Q Consensus        33 ~~~~~~c~~c~~~id~s~v~~~~~~LP-pGfRF~PTDeELI~~YL~k   78 (424)
                      .+-|..||+|++.+=..|+-....-.| -|+.|+=+-.|.|..+|-.
T Consensus        25 e~lw~KCp~c~~~~y~~eL~~n~~vcp~c~~h~ri~A~~Ri~~llD~   71 (294)
T COG0777          25 EGLWTKCPSCGEMLYRKELESNLKVCPKCGHHMRISARERLEALLDE   71 (294)
T ss_pred             CCceeECCCccceeeHHHHHhhhhcccccCcccccCHHHHHHHhhCC
Confidence            788999999999998888877666667 7999999999999987643


No 11 
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=22.50  E-value=64  Score=24.62  Aligned_cols=26  Identities=27%  Similarity=0.635  Sum_probs=20.2

Q ss_pred             cCCCCCccccCCCcCCCCCCCCCCcee
Q 014445           38 ACPNCHHVIDNSDVAHEWPGLPRGVKF   64 (424)
Q Consensus        38 ~c~~c~~~id~s~v~~~~~~LPpGfRF   64 (424)
                      .|..|+++.|... -...-++|||-.|
T Consensus         3 ~C~~CgyiYd~~~-Gd~~~~i~pGt~f   28 (50)
T cd00730           3 ECRICGYIYDPAE-GDPDEGIPPGTPF   28 (50)
T ss_pred             CCCCCCeEECCCC-CCcccCcCCCCCH
Confidence            6999999999754 4445678888877


No 12 
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=21.43  E-value=47  Score=34.09  Aligned_cols=46  Identities=15%  Similarity=0.102  Sum_probs=36.9

Q ss_pred             CCCCccCCCCCccccCCCcCCCCCCCC-CCceeCCChHHHHHHHHHh
Q 014445           33 SNPTKACPNCHHVIDNSDVAHEWPGLP-RGVKFDPSDQEIIWHLLAK   78 (424)
Q Consensus        33 ~~~~~~c~~c~~~id~s~v~~~~~~LP-pGfRF~PTDeELI~~YL~k   78 (424)
                      .+-|..||+|++.|...++.....--| =|+.|.-|-.|-|..+|-+
T Consensus        35 ~~lw~kc~~C~~~~~~~~l~~~~~vcp~c~~h~rltAreRI~~L~D~   81 (296)
T CHL00174         35 KHLWVQCENCYGLNYKKFLKSKMNICEQCGYHLKMSSSDRIELLIDP   81 (296)
T ss_pred             CCCeeECCCccchhhHHHHHHcCCCCCCCCCCcCCCHHHHHHHHccC
Confidence            346899999999998888755555556 7999999999999977643


Done!