Citrus Sinensis ID: 014477
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 424 | ||||||
| 255554136 | 411 | DNA binding protein, putative [Ricinus c | 0.846 | 0.873 | 0.701 | 1e-139 | |
| 225433544 | 400 | PREDICTED: transcription factor FAMA [Vi | 0.886 | 0.94 | 0.696 | 1e-139 | |
| 356502696 | 430 | PREDICTED: transcription factor FAMA-lik | 0.948 | 0.934 | 0.623 | 1e-134 | |
| 298205263 | 367 | unnamed protein product [Vitis vinifera] | 0.856 | 0.989 | 0.656 | 1e-128 | |
| 356494798 | 811 | PREDICTED: uncharacterized protein LOC10 | 0.903 | 0.472 | 0.629 | 1e-127 | |
| 147841337 | 422 | hypothetical protein VITISV_027832 [Viti | 0.818 | 0.822 | 0.689 | 1e-124 | |
| 297831198 | 400 | hypothetical protein ARALYDRAFT_898955 [ | 0.863 | 0.915 | 0.624 | 1e-120 | |
| 30687365 | 414 | transcription factor FAMA [Arabidopsis t | 0.872 | 0.893 | 0.599 | 1e-116 | |
| 11994233 | 380 | unnamed protein product [Arabidopsis tha | 0.825 | 0.921 | 0.587 | 1e-101 | |
| 413948632 | 420 | putative HLH DNA-binding domain superfam | 0.820 | 0.828 | 0.510 | 1e-94 |
| >gi|255554136|ref|XP_002518108.1| DNA binding protein, putative [Ricinus communis] gi|223542704|gb|EEF44241.1| DNA binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 502 bits (1292), Expect = e-139, Method: Compositional matrix adjust.
Identities = 287/409 (70%), Positives = 318/409 (77%), Gaps = 50/409 (12%)
Query: 4 ELNY-SANFQGLDYSLDHHHHHHQEEL----IMKPRIGDTSDDRNNNHGMIDYMINNNPQ 58
EL++ A F LDYSLDHHHHHH + ++KPRIG+TS D +N GMIDYM+NN
Sbjct: 6 ELDFLQATFTSLDYSLDHHHHHHHHQPQQHELIKPRIGETSGD--SNSGMIDYMLNN--- 60
Query: 59 PRPQIQQQVSSSSSGFCTSNSFDKLSFADVMQFAEFGPKLSINQTNNRVNVPEEETGIID 118
P Q+ SSSGFCTSNS DKLSFADVMQFA+FGPKL++NQT + EEETGI D
Sbjct: 61 PHQQL-----ISSSGFCTSNSLDKLSFADVMQFADFGPKLALNQTK----ISEEETGI-D 110
Query: 119 PVYFLKFPVLNDKLDEDDEHSLMLPQPGGCNENESFK-----------DNDEIRVSDNNS 167
PVYFLKFPVLNDK + SLM+PQ G NE E FK + +E RVSDN S
Sbjct: 111 PVYFLKFPVLNDK---REGQSLMIPQLGEENEEERFKGMGSVERFTGREEEETRVSDNAS 167
Query: 168 VQQQLRFLEDDVQNNKSVVNNGPEAKNKRKRPRAIKTTEEVESQRMTHIAVERNRRKQMN 227
VQ L+FLE+ NK+ + PE KNKRKRPR KT+EEVESQRMTHIAVERNRRKQMN
Sbjct: 168 VQ--LQFLENQDAQNKNPI---PEVKNKRKRPRTTKTSEEVESQRMTHIAVERNRRKQMN 222
Query: 228 EHLRVLRSLMPGSYVQRGDQASIIGGAIEFVRELEQLLQCLESQKRRRILGEAAAAPGGG 287
EHLRVLRSLMPGSYVQRGDQASIIGGAIEFVRELEQLLQCLESQKRRR+ G+AA+
Sbjct: 223 EHLRVLRSLMPGSYVQRGDQASIIGGAIEFVRELEQLLQCLESQKRRRLYGDAAS----- 277
Query: 288 RQM-GDSSMAINQQPQTPLFPPPLPFPNDQIKLMDFETGLREETAENKSCLADVEVKLLG 346
RQM G+SS+A+ QQPQ+P F P PNDQ+KL+ FETGLREETAENKSCLADVEVKLLG
Sbjct: 278 RQMAGESSVAV-QQPQSPFF----PLPNDQMKLVQFETGLREETAENKSCLADVEVKLLG 332
Query: 347 LDAMIKILSRRRPGQLIKAIAALEDLQFNILHTNITTIEQTVLYSFNVK 395
DAMIKILSRRRPGQLIK IAALEDLQ NILHTNITTIEQTVLYSFNVK
Sbjct: 333 FDAMIKILSRRRPGQLIKTIAALEDLQLNILHTNITTIEQTVLYSFNVK 381
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225433544|ref|XP_002266835.1| PREDICTED: transcription factor FAMA [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356502696|ref|XP_003520153.1| PREDICTED: transcription factor FAMA-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|298205263|emb|CBI17322.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356494798|ref|XP_003516270.1| PREDICTED: uncharacterized protein LOC100813515 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|147841337|emb|CAN60177.1| hypothetical protein VITISV_027832 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297831198|ref|XP_002883481.1| hypothetical protein ARALYDRAFT_898955 [Arabidopsis lyrata subsp. lyrata] gi|297329321|gb|EFH59740.1| hypothetical protein ARALYDRAFT_898955 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|30687365|ref|NP_189056.2| transcription factor FAMA [Arabidopsis thaliana] gi|75283553|sp|Q56YJ8.1|FAMA_ARATH RecName: Full=Transcription factor FAMA; AltName: Full=Basic helix-loop-helix protein 97; Short=AtbHLH97; Short=bHLH 97; AltName: Full=Transcription factor EN 14; AltName: Full=bHLH transcription factor bHLH097 gi|62319997|dbj|BAD94119.1| putative bHLH transcription factor [Arabidopsis thaliana] gi|114213507|gb|ABI54336.1| At3g24140 [Arabidopsis thaliana] gi|332643341|gb|AEE76862.1| transcription factor FAMA [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|11994233|dbj|BAB01355.1| unnamed protein product [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|413948632|gb|AFW81281.1| putative HLH DNA-binding domain superfamily protein [Zea mays] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 424 | ||||||
| TAIR|locus:2093746 | 414 | FMA "AT3G24140" [Arabidopsis t | 0.889 | 0.910 | 0.555 | 3.4e-100 | |
| UNIPROTKB|Q6ZGS3 | 373 | OJ1148_D05.9 "Putative basic-h | 0.165 | 0.187 | 0.7 | 1.1e-39 | |
| TAIR|locus:2009537 | 304 | AT1G22490 "AT1G22490" [Arabido | 0.165 | 0.230 | 0.714 | 6.5e-39 | |
| TAIR|locus:2207061 | 320 | AT1G72210 "AT1G72210" [Arabido | 0.325 | 0.431 | 0.431 | 1.3e-38 | |
| UNIPROTKB|Q8H7N8 | 329 | OJ1217B09.8 "BHLH transcriptio | 0.544 | 0.702 | 0.385 | 2.6e-38 | |
| UNIPROTKB|Q6K4B1 | 351 | OJ1595_D08.4 "Os09g0468700 pro | 0.533 | 0.643 | 0.423 | 1.1e-37 | |
| UNIPROTKB|Q6YTU1 | 363 | P0419H09.4 "cDNA clone:002-131 | 0.533 | 0.622 | 0.419 | 1.9e-37 | |
| TAIR|locus:2116977 | 315 | AT4G01460 "AT4G01460" [Arabido | 0.231 | 0.311 | 0.55 | 3.9e-35 | |
| TAIR|locus:2044387 | 371 | AT2G46810 "AT2G46810" [Arabido | 0.294 | 0.336 | 0.425 | 3.4e-34 | |
| TAIR|locus:2154197 | 364 | SPCH "AT5G53210" [Arabidopsis | 0.212 | 0.247 | 0.455 | 4.4e-34 |
| TAIR|locus:2093746 FMA "AT3G24140" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 994 (355.0 bits), Expect = 3.4e-100, P = 3.4e-100
Identities = 225/405 (55%), Positives = 275/405 (67%)
Query: 35 IGDTSDDRNNNH-GMIDYM----IXXXXXXXXXXXXXXXXXXXGFCTSNSFDKLSFADVM 89
+G++S ++N GMIDYM + GF + FDK++F+DVM
Sbjct: 11 LGESSGGNDDNSSGMIDYMFNRNLQQQQKQSMPQQQQHQLSPSGF-GATPFDKMNFSDVM 69
Query: 90 QFAEFGPKLSINQTNNRVNVPEEETGIIDPVYFLKFPVLNDKLDEDDEHSLMLP-----Q 144
QFA+FG KL++NQT N+ ++ETGI DPVYFLKFPVLNDK+++ ++ ++P Q
Sbjct: 70 QFADFGSKLALNQTRNQ---DDQETGI-DPVYFLKFPVLNDKIEDHNQTQHLMPSHQTSQ 125
Query: 145 PGG-CNEN--ESFKDNDEIRVSDNNSVQQQLRFL--EDDVQNNKSVVNNGPEAKNKRKRP 199
GG C N F + E + DN++ QLRF+ E++ + NK+V E K+KRKR
Sbjct: 126 EGGECGGNIGNVFLEEKEDQDDDNDNNSVQLRFIGGEEEDRENKNVTKK--EVKSKRKRA 183
Query: 200 RAIKTTEEVESQRMTHIAVERNRRKQMNEHLRVLRSLMPGSYVQRGDQASIIGGAIEFVR 259
R KT+EEVESQRMTHIAVERNRRKQMNEHLRVLRSLMPGSYVQRGDQASIIGGAIEFVR
Sbjct: 184 RTSKTSEEVESQRMTHIAVERNRRKQMNEHLRVLRSLMPGSYVQRGDQASIIGGAIEFVR 243
Query: 260 XXXXXXXXXXXXKRRRILGEAAAAPGGGRQMGDSSMAINXXXXXXXXXXXXXXXNDQIKL 319
KRRRILGE GR M ++ + + +
Sbjct: 244 ELEQLLQCLESQKRRRILGET------GRDMTTTTTSSSSPITTVANQAQPLIITGNVTE 297
Query: 320 MDFETGLREETAENKSCLADVEVKLLGLDAMIKILSRRRPGQLIKAIAALEDLQFNILHT 379
++ GLREETAENKSCLADVEVKLLG DAMIKILSRRRPGQLIK IAALEDL +ILHT
Sbjct: 298 LEGGGGLREETAENKSCLADVEVKLLGFDAMIKILSRRRPGQLIKTIAALEDLHLSILHT 357
Query: 380 NITTIEQTVLYSFNVKVASETRFTADDIASSVQQVFSFIHANSSM 424
NITT+EQTVLYSFNVK+ SETRFTA+DIASS+QQ+FSFIHAN+++
Sbjct: 358 NITTMEQTVLYSFNVKITSETRFTAEDIASSIQQIFSFIHANTNI 402
|
|
| UNIPROTKB|Q6ZGS3 OJ1148_D05.9 "Putative basic-helix-loop-helix transcription factor" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2009537 AT1G22490 "AT1G22490" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2207061 AT1G72210 "AT1G72210" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8H7N8 OJ1217B09.8 "BHLH transcription factor" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6K4B1 OJ1595_D08.4 "Os09g0468700 protein" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6YTU1 P0419H09.4 "cDNA clone:002-131-D10, full insert sequence" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2116977 AT4G01460 "AT4G01460" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2044387 AT2G46810 "AT2G46810" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2154197 SPCH "AT5G53210" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00031699001 | SubName- Full=Chromosome chr5 scaffold_58, whole genome shotgun sequence; (400 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 424 | |||
| cd00083 | 60 | cd00083, HLH, Helix-loop-helix domain, found in sp | 9e-12 | |
| pfam00010 | 52 | pfam00010, HLH, Helix-loop-helix DNA-binding domai | 5e-11 | |
| smart00353 | 53 | smart00353, HLH, helix loop helix domain | 2e-07 |
| >gnl|CDD|238036 cd00083, HLH, Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long | Back alignment and domain information |
|---|
Score = 59.5 bits (145), Expect = 9e-12
Identities = 20/59 (33%), Positives = 38/59 (64%), Gaps = 1/59 (1%)
Query: 209 ESQRMTHIAVERNRRKQMNEHLRVLRSLMPGSYV-QRGDQASIIGGAIEFVRELEQLLQ 266
+S+R H ER RR+++N+ LRSL+P ++ +A I+ A+++++ L++LLQ
Sbjct: 2 KSRREAHNLRERRRRERINDAFDELRSLLPTLPPSKKLSKAEILRKAVDYIKSLQELLQ 60
|
A DNA-binding basic region is followed by two alpha-helices separated by a variable loop region; HLH forms homo- and heterodimers, dimerization creates a parallel, left-handed, four helix bundle; the basic region N-terminal to the first amphipathic helix mediates high-affinity DNA-binding; there are several groups of HLH proteins: those (E12/E47) which bind specific hexanucleotide sequences such as E-box (5-CANNTG-3) or StRE 5-ATCACCCCAC-3), those lacking the basic domain (Emc, Id) function as negative regulators since they fail to bind DNA, those (hairy, E(spl), deadpan) which repress transcription although they can bind specific hexanucleotide sequences such as N-box (5-CACGc/aG-3), those which have a COE domain (Collier/Olf-1/EBF) which is involved in both in dimerization and in DNA binding, and those which bind pentanucleotides ACGTG or GCGTG and have a PAS domain which allows the dimerization between PAS proteins, the binding of small molecules (e.g., dioxin), and interactions with non-PAS proteins. Length = 60 |
| >gnl|CDD|215654 pfam00010, HLH, Helix-loop-helix DNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|197674 smart00353, HLH, helix loop helix domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 424 | |||
| PF00010 | 55 | HLH: Helix-loop-helix DNA-binding domain only nucl | 99.32 | |
| cd00083 | 60 | HLH Helix-loop-helix domain, found in specific DNA | 99.28 | |
| smart00353 | 53 | HLH helix loop helix domain. | 99.23 | |
| KOG1318 | 411 | consensus Helix loop helix transcription factor EB | 98.68 | |
| cd04897 | 75 | ACT_ACR_3 ACT domain-containing protein which is c | 98.35 | |
| cd04895 | 72 | ACT_ACR_1 ACT domain-containing protein which is c | 98.34 | |
| KOG1319 | 229 | consensus bHLHZip transcription factor BIGMAX [Tra | 98.29 | |
| cd04900 | 73 | ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, | 98.13 | |
| cd04927 | 76 | ACT_ACR-like_2 Second ACT domain, of a novel type | 98.12 | |
| cd04896 | 75 | ACT_ACR-like_3 ACT domain-containing protein which | 98.07 | |
| KOG3960 | 284 | consensus Myogenic helix-loop-helix transcription | 97.97 | |
| KOG2483 | 232 | consensus Upstream transcription factor 2/L-myc-2 | 97.97 | |
| KOG4304 | 250 | consensus Transcriptional repressors of the hairy/ | 97.93 | |
| cd04925 | 74 | ACT_ACR_2 ACT domain-containing protein which is c | 97.93 | |
| KOG3561 | 803 | consensus Aryl-hydrocarbon receptor nuclear transl | 97.83 | |
| cd04899 | 70 | ACT_ACR-UUR-like_2 C-terminal ACT domains of the b | 97.72 | |
| cd04926 | 72 | ACT_ACR_4 C-terminal ACT domain, of a novel type o | 97.5 | |
| cd04928 | 68 | ACT_TyrKc Uncharacterized, N-terminal ACT domain o | 97.43 | |
| KOG4029 | 228 | consensus Transcription factor HAND2/Transcription | 97.38 | |
| KOG2588 | 953 | consensus Predicted DNA-binding protein [Transcrip | 97.19 | |
| KOG0561 | 373 | consensus bHLH transcription factor [Transcription | 97.17 | |
| cd04873 | 70 | ACT_UUR-ACR-like ACT domains of the bacterial sign | 97.15 | |
| PF13740 | 76 | ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. | 97.03 | |
| PRK05007 | 884 | PII uridylyl-transferase; Provisional | 97.03 | |
| PLN03217 | 93 | transcription factor ATBS1; Provisional | 96.97 | |
| PF01842 | 66 | ACT: ACT domain; InterPro: IPR002912 The ACT domai | 96.89 | |
| PRK00275 | 895 | glnD PII uridylyl-transferase; Provisional | 96.8 | |
| KOG4447 | 173 | consensus Transcription factor TWIST [Transcriptio | 96.8 | |
| PRK04374 | 869 | PII uridylyl-transferase; Provisional | 96.7 | |
| cd04893 | 77 | ACT_GcvR_1 ACT domains that comprise the Glycine C | 96.67 | |
| PRK01759 | 854 | glnD PII uridylyl-transferase; Provisional | 96.58 | |
| PRK03381 | 774 | PII uridylyl-transferase; Provisional | 96.49 | |
| PF13291 | 80 | ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A. | 96.49 | |
| cd04869 | 81 | ACT_GcvR_2 ACT domains that comprise the Glycine C | 96.47 | |
| PRK05092 | 931 | PII uridylyl-transferase; Provisional | 96.47 | |
| PRK03381 | 774 | PII uridylyl-transferase; Provisional | 96.44 | |
| cd04872 | 88 | ACT_1ZPV ACT domain proteins similar to the yet un | 96.44 | |
| cd04875 | 74 | ACT_F4HF-DF N-terminal ACT domain of formyltetrahy | 96.37 | |
| PRK00194 | 90 | hypothetical protein; Validated | 96.35 | |
| KOG3910 | 632 | consensus Helix loop helix transcription factor [T | 96.29 | |
| cd04870 | 75 | ACT_PSP_1 CT domains found N-terminal of phosphose | 96.23 | |
| TIGR01693 | 850 | UTase_glnD [Protein-PII] uridylyltransferase. This | 96.14 | |
| TIGR01693 | 850 | UTase_glnD [Protein-PII] uridylyltransferase. This | 96.12 | |
| PRK05007 | 884 | PII uridylyl-transferase; Provisional | 96.01 | |
| cd04887 | 74 | ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te | 96.01 | |
| PRK03059 | 856 | PII uridylyl-transferase; Provisional | 95.96 | |
| PRK01759 | 854 | glnD PII uridylyl-transferase; Provisional | 95.74 | |
| COG2844 | 867 | GlnD UTP:GlnB (protein PII) uridylyltransferase [P | 95.61 | |
| cd04886 | 73 | ACT_ThrD-II-like C-terminal ACT domain of biodegra | 95.49 | |
| PRK03059 | 856 | PII uridylyl-transferase; Provisional | 95.39 | |
| PRK05092 | 931 | PII uridylyl-transferase; Provisional | 95.24 | |
| cd04888 | 76 | ACT_PheB-BS C-terminal ACT domain of a small (~147 | 95.03 | |
| PRK00275 | 895 | glnD PII uridylyl-transferase; Provisional | 94.92 | |
| PRK04435 | 147 | hypothetical protein; Provisional | 94.74 | |
| cd02116 | 60 | ACT ACT domains are commonly involved in specifica | 94.57 | |
| PRK04374 | 869 | PII uridylyl-transferase; Provisional | 94.06 | |
| cd04894 | 69 | ACT_ACR-like_1 ACT domain-containing protein which | 93.65 | |
| cd04876 | 71 | ACT_RelA-SpoT ACT domain found C-terminal of the R | 93.57 | |
| cd04881 | 79 | ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-termin | 93.47 | |
| cd04880 | 75 | ACT_AAAH-PDT-like ACT domain of the nonheme iron-d | 93.34 | |
| cd04877 | 74 | ACT_TyrR N-terminal ACT domain of the TyrR protein | 93.23 | |
| cd04874 | 72 | ACT_Af1403 N-terminal ACT domain of the yet unchar | 92.47 | |
| cd04878 | 72 | ACT_AHAS N-terminal ACT domain of the Escherichia | 92.44 | |
| PRK13011 | 286 | formyltetrahydrofolate deformylase; Reviewed | 92.43 | |
| cd04884 | 72 | ACT_CBS C-terminal ACT domain of the cystathionine | 92.24 | |
| cd04905 | 80 | ACT_CM-PDT C-terminal ACT domain of the bifunction | 92.12 | |
| PRK08577 | 136 | hypothetical protein; Provisional | 92.03 | |
| KOG3898 | 254 | consensus Transcription factor NeuroD and related | 91.94 | |
| cd04879 | 71 | ACT_3PGDH-like ACT_3PGDH-like CD includes the C-te | 91.93 | |
| cd04903 | 71 | ACT_LSD C-terminal ACT domain of the L-serine dehy | 91.88 | |
| KOG3560 | 712 | consensus Aryl-hydrocarbon receptor [Transcription | 91.87 | |
| PRK06027 | 286 | purU formyltetrahydrofolate deformylase; Reviewed | 91.64 | |
| PRK13010 | 289 | purU formyltetrahydrofolate deformylase; Reviewed | 91.47 | |
| TIGR00655 | 280 | PurU formyltetrahydrofolate deformylase. This mode | 91.0 | |
| PRK07334 | 403 | threonine dehydratase; Provisional | 90.99 | |
| cd04882 | 65 | ACT_Bt0572_2 C-terminal ACT domain of a novel prot | 90.9 | |
| cd04908 | 66 | ACT_Bt0572_1 N-terminal ACT domain of a novel prot | 90.07 | |
| cd04929 | 74 | ACT_TPH ACT domain of the nonheme iron-dependent a | 90.03 | |
| cd04883 | 72 | ACT_AcuB C-terminal ACT domain of the Bacillus sub | 89.96 | |
| cd04904 | 74 | ACT_AAAH ACT domain of the nonheme iron-dependent, | 89.34 | |
| cd04909 | 69 | ACT_PDH-BS C-terminal ACT domain of the monofuncti | 89.22 | |
| cd04931 | 90 | ACT_PAH ACT domain of the nonheme iron-dependent a | 88.57 | |
| cd04889 | 56 | ACT_PDH-BS-like C-terminal ACT domain of the monof | 87.02 | |
| PF05088 | 1528 | Bac_GDH: Bacterial NAD-glutamate dehydrogenase | 87.01 | |
| COG2844 | 867 | GlnD UTP:GlnB (protein PII) uridylyltransferase [P | 86.67 | |
| CHL00100 | 174 | ilvH acetohydroxyacid synthase small subunit | 86.06 | |
| PRK13562 | 84 | acetolactate synthase 1 regulatory subunit; Provis | 85.64 | |
| KOG3558 | 768 | consensus Hypoxia-inducible factor 1/Neuronal PAS | 85.61 | |
| cd04901 | 69 | ACT_3PGDH C-terminal ACT (regulatory) domain of D- | 85.36 | |
| PRK11589 | 190 | gcvR glycine cleavage system transcriptional repre | 84.4 | |
| cd04902 | 73 | ACT_3PGDH-xct C-terminal ACT (regulatory) domain o | 84.17 | |
| KOG3559 | 598 | consensus Transcriptional regulator SIM1 [Transcri | 83.82 | |
| TIGR00119 | 157 | acolac_sm acetolactate synthase, small subunit. ac | 83.72 | |
| PRK11152 | 76 | ilvM acetolactate synthase 2 regulatory subunit; P | 83.59 | |
| PRK06737 | 76 | acetolactate synthase 1 regulatory subunit; Valida | 83.17 | |
| cd04885 | 68 | ACT_ThrD-I Tandem C-terminal ACT domains of threon | 83.06 | |
| COG3830 | 90 | ACT domain-containing protein [Signal transduction | 82.73 | |
| PRK11895 | 161 | ilvH acetolactate synthase 3 regulatory subunit; R | 82.48 | |
| cd04922 | 66 | ACT_AKi-HSDH-ThrA_2 ACT domains of the bifunctiona | 80.93 | |
| COG0788 | 287 | PurU Formyltetrahydrofolate hydrolase [Nucleotide | 80.77 | |
| COG4492 | 150 | PheB ACT domain-containing protein [General functi | 80.76 |
| >PF00010 HLH: Helix-loop-helix DNA-binding domain only nuclear translocator protein (Arnt) | Back alignment and domain information |
|---|
Probab=99.32 E-value=2.4e-12 Score=97.38 Aligned_cols=52 Identities=33% Similarity=0.599 Sum_probs=48.1
Q ss_pred hhcchhHHHHHHHHHHHHHHHHHHccCCCC---CCCCCCccchHHHHHHHHHHHH
Q 014477 211 QRMTHIAVERNRRKQMNEHLRVLRSLMPGS---YVQRGDQASIIGGAIEFVRELE 262 (424)
Q Consensus 211 ~r~~H~~aER~RR~kmn~~f~~LrsLvP~~---~~~K~dKaSIL~eAI~YIk~Lq 262 (424)
+|..|+.+||+||.+||+.|..|+.+||.. ...|.+|++||..||+||++||
T Consensus 1 rR~~h~~~Er~RR~~i~~~~~~L~~llp~~~~~~~~k~~K~~iL~~ai~yI~~Lq 55 (55)
T PF00010_consen 1 RRQKHNERERRRRDRINDCFDELRELLPSCSAGSSRKLSKASILQKAIDYIKQLQ 55 (55)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHCCSSHHCCTTSSSSHHHHHHHHHHHHHHHH
T ss_pred CCchHHHHHHHHHHHHHHHHHHHHHhccchhccccccCCHHHHHHHHHHHHHHhC
Confidence 367899999999999999999999999985 4578999999999999999997
|
; InterPro: IPR011598 The helix-loop-helix (HLH) DNA-binding domain consists of a closed bundle of four helices in a left-handed twist with two crossover connections. The HLH domain directs dimerisation, and is juxtaposed to basic regions to create a DNA interaction interface surface that recognises specific DNA sequences. Basic region/HLH (bHLH) proteins regulate diverse biological pathways []. bHLH proteins include MyoD [], SREBPs (sterol regulatory element binding proteins) [], and yeast Pho4 (phosphatase system) []. In certain proteins the bHLH domain contains a leucine-zipper motif. The bHLH/leucine zipper (bHLHZip) domain specifies dimerisation within a network of proteins and determines sequence-specific DNA binding []. bHLHZip domains occur in the transcription factors Myc, Mad, Max and Usf [, ]. This entry is bHLHZip, which covers the bHLH domain and the leucine zipper motif, when present.; PDB: 1NLW_A 1NKP_D 1A93_A 2A93_A 1AM9_C 3U5V_A 1A0A_B 2QL2_C 1UKL_C 1AN4_B .... |
| >cd00083 HLH Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long | Back alignment and domain information |
|---|
| >smart00353 HLH helix loop helix domain | Back alignment and domain information |
|---|
| >KOG1318 consensus Helix loop helix transcription factor EB [Transcription] | Back alignment and domain information |
|---|
| >cd04897 ACT_ACR_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >KOG1319 consensus bHLHZip transcription factor BIGMAX [Transcription] | Back alignment and domain information |
|---|
| >cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >KOG3960 consensus Myogenic helix-loop-helix transcription factor [Transcription] | Back alignment and domain information |
|---|
| >KOG2483 consensus Upstream transcription factor 2/L-myc-2 protein [Transcription] | Back alignment and domain information |
|---|
| >KOG4304 consensus Transcriptional repressors of the hairy/E(spl) family (contains HLH) [Transcription] | Back alignment and domain information |
|---|
| >cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >KOG3561 consensus Aryl-hydrocarbon receptor nuclear translocator [Transcription] | Back alignment and domain information |
|---|
| >cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains | Back alignment and domain information |
|---|
| >KOG4029 consensus Transcription factor HAND2/Transcription factor TAL1/TAL2/LYL1 [Transcription] | Back alignment and domain information |
|---|
| >KOG2588 consensus Predicted DNA-binding protein [Transcription] | Back alignment and domain information |
|---|
| >KOG0561 consensus bHLH transcription factor [Transcription] | Back alignment and domain information |
|---|
| >cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD | Back alignment and domain information |
|---|
| >PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A | Back alignment and domain information |
|---|
| >PRK05007 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PLN03217 transcription factor ATBS1; Provisional | Back alignment and domain information |
|---|
| >PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold | Back alignment and domain information |
|---|
| >PRK00275 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >KOG4447 consensus Transcription factor TWIST [Transcription] | Back alignment and domain information |
|---|
| >PRK04374 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains | Back alignment and domain information |
|---|
| >PRK01759 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK03381 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A | Back alignment and domain information |
|---|
| >cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains | Back alignment and domain information |
|---|
| >PRK05092 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK03381 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein | Back alignment and domain information |
|---|
| >cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) | Back alignment and domain information |
|---|
| >PRK00194 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG3910 consensus Helix loop helix transcription factor [Transcription] | Back alignment and domain information |
|---|
| >cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) | Back alignment and domain information |
|---|
| >TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase | Back alignment and domain information |
|---|
| >TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase | Back alignment and domain information |
|---|
| >PRK05007 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains | Back alignment and domain information |
|---|
| >PRK03059 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK01759 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains | Back alignment and domain information |
|---|
| >PRK03059 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK05092 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a | Back alignment and domain information |
|---|
| >PRK00275 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK04435 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme | Back alignment and domain information |
|---|
| >PRK04374 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04894 ACT_ACR-like_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains | Back alignment and domain information |
|---|
| >cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains | Back alignment and domain information |
|---|
| >cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) | Back alignment and domain information |
|---|
| >cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein | Back alignment and domain information |
|---|
| >cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a | Back alignment and domain information |
|---|
| >cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) | Back alignment and domain information |
|---|
| >PRK13011 formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria | Back alignment and domain information |
|---|
| >cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme | Back alignment and domain information |
|---|
| >PRK08577 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG3898 consensus Transcription factor NeuroD and related HTH proteins [Transcription] | Back alignment and domain information |
|---|
| >cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) | Back alignment and domain information |
|---|
| >cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit | Back alignment and domain information |
|---|
| >KOG3560 consensus Aryl-hydrocarbon receptor [Transcription] | Back alignment and domain information |
|---|
| >PRK06027 purU formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >PRK13010 purU formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00655 PurU formyltetrahydrofolate deformylase | Back alignment and domain information |
|---|
| >PRK07334 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains | Back alignment and domain information |
|---|
| >cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains | Back alignment and domain information |
|---|
| >cd04929 ACT_TPH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes | Back alignment and domain information |
|---|
| >cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB | Back alignment and domain information |
|---|
| >cd04904 ACT_AAAH ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) | Back alignment and domain information |
|---|
| >cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) | Back alignment and domain information |
|---|
| >cd04931 ACT_PAH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, phenylalanine hydroxylases (PAH) | Back alignment and domain information |
|---|
| >cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate | Back alignment and domain information |
|---|
| >PF05088 Bac_GDH: Bacterial NAD-glutamate dehydrogenase | Back alignment and domain information |
|---|
| >COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >CHL00100 ilvH acetohydroxyacid synthase small subunit | Back alignment and domain information |
|---|
| >PRK13562 acetolactate synthase 1 regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >KOG3558 consensus Hypoxia-inducible factor 1/Neuronal PAS domain protein NPAS1 [Signal transduction mechanisms; Transcription] | Back alignment and domain information |
|---|
| >cd04901 ACT_3PGDH C-terminal ACT (regulatory) domain of D-3-Phosphoglycerate Dehydrogenase (3PGDH) found in fungi and bacteria | Back alignment and domain information |
|---|
| >PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional | Back alignment and domain information |
|---|
| >cd04902 ACT_3PGDH-xct C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) | Back alignment and domain information |
|---|
| >KOG3559 consensus Transcriptional regulator SIM1 [Transcription] | Back alignment and domain information |
|---|
| >TIGR00119 acolac_sm acetolactate synthase, small subunit | Back alignment and domain information |
|---|
| >PRK11152 ilvM acetolactate synthase 2 regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >PRK06737 acetolactate synthase 1 regulatory subunit; Validated | Back alignment and domain information |
|---|
| >cd04885 ACT_ThrD-I Tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) | Back alignment and domain information |
|---|
| >COG3830 ACT domain-containing protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11895 ilvH acetolactate synthase 3 regulatory subunit; Reviewed | Back alignment and domain information |
|---|
| >cd04922 ACT_AKi-HSDH-ThrA_2 ACT domains of the bifunctional enzyme aspartokinase (AK) - homoserine dehydrogenase (HSDH) | Back alignment and domain information |
|---|
| >COG0788 PurU Formyltetrahydrofolate hydrolase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG4492 PheB ACT domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 424 | |||
| 1nkp_B | 83 | MAX protein, MYC proto-oncogene protein; transcrip | 6e-10 | |
| 1nkp_A | 88 | C-MYC, MYC proto-oncogene protein; transcription, | 1e-09 | |
| 1am9_A | 82 | Srebp-1A, protein (sterol regulatory element bindi | 4e-09 | |
| 1hlo_A | 80 | Protein (transcription factor MAX); transcriptiona | 4e-09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-08 | |
| 1nlw_A | 80 | MAD protein, MAX dimerizer; transcription factor, | 5e-08 | |
| 1an4_A | 65 | Protein (upstream stimulatory factor); protein-DNA | 8e-06 | |
| 1a0a_A | 63 | BHLH, protein (phosphate system positive regulator | 3e-05 |
| >1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Length = 83 | Back alignment and structure |
|---|
Score = 54.7 bits (132), Expect = 6e-10
Identities = 14/64 (21%), Positives = 29/64 (45%)
Query: 211 QRMTHIAVERNRRKQMNEHLRVLRSLMPGSYVQRGDQASIIGGAIEFVRELEQLLQCLES 270
+R H A+ER RR + + LR +P ++ +A I+ A E+++ + + +
Sbjct: 2 KRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNHTHQQ 61
Query: 271 QKRR 274
Sbjct: 62 DIDD 65
|
| >1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Length = 88 | Back alignment and structure |
|---|
| >1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Length = 82 | Back alignment and structure |
|---|
| >1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Length = 80 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Length = 80 | Back alignment and structure |
|---|
| >1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Length = 65 | Back alignment and structure |
|---|
| >1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Length = 63 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 424 | |||
| 1am9_A | 82 | Srebp-1A, protein (sterol regulatory element bindi | 99.56 | |
| 1hlo_A | 80 | Protein (transcription factor MAX); transcriptiona | 99.49 | |
| 1nkp_B | 83 | MAX protein, MYC proto-oncogene protein; transcrip | 99.48 | |
| 4h10_B | 71 | Circadian locomoter output cycles protein kaput; B | 99.45 | |
| 1nkp_A | 88 | C-MYC, MYC proto-oncogene protein; transcription, | 99.44 | |
| 1an4_A | 65 | Protein (upstream stimulatory factor); protein-DNA | 99.4 | |
| 4ati_A | 118 | MITF, microphthalmia-associated transcription fact | 99.38 | |
| 1a0a_A | 63 | BHLH, protein (phosphate system positive regulator | 99.37 | |
| 1nlw_A | 80 | MAD protein, MAX dimerizer; transcription factor, | 99.36 | |
| 4h10_A | 73 | ARYL hydrocarbon receptor nuclear translocator-LI | 99.33 | |
| 3u5v_A | 76 | Protein MAX, transcription factor E2-alpha chimer; | 99.29 | |
| 1mdy_A | 68 | Protein (MYOD BHLH domain); protein-DNA complex, t | 99.15 | |
| 2ql2_B | 60 | Neurod1, neurogenic differentiation factor 1; basi | 99.05 | |
| 4f3l_A | 361 | Mclock, circadian locomoter output cycles protein | 98.74 | |
| 4f3l_B | 387 | BMAL1B; BHLH, PAS, circadian rhythm proteins, tran | 98.58 | |
| 2lfh_A | 68 | DNA-binding protein inhibitor ID-3; structural gen | 98.4 | |
| 4ath_A | 83 | MITF, microphthalmia-associated transcription fact | 97.99 | |
| 4aya_A | 97 | DNA-binding protein inhibitor ID-2; cell cycle; 2. | 97.78 | |
| 1zpv_A | 91 | ACT domain protein; structural genomics, PSI, prot | 97.19 | |
| 1u8s_A | 192 | Glycine cleavage system transcriptional repressor, | 96.47 | |
| 2nyi_A | 195 | Unknown protein; protein structure initiative, PSI | 95.94 | |
| 2ko1_A | 88 | CTR148A, GTP pyrophosphokinase; homodimer, alpha+b | 95.69 | |
| 1u8s_A | 192 | Glycine cleavage system transcriptional repressor, | 95.47 | |
| 2nyi_A | 195 | Unknown protein; protein structure initiative, PSI | 95.46 | |
| 3n0v_A | 286 | Formyltetrahydrofolate deformylase; formyl transfe | 92.27 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 91.95 | |
| 3o1l_A | 302 | Formyltetrahydrofolate deformylase; structural gen | 91.01 | |
| 2jhe_A | 190 | Transcription regulator TYRR; aromatic hydrocarbon | 90.4 | |
| 3lou_A | 292 | Formyltetrahydrofolate deformylase; structural gen | 90.34 | |
| 3obi_A | 288 | Formyltetrahydrofolate deformylase; structural gen | 90.25 | |
| 2f1f_A | 164 | Acetolactate synthase isozyme III small subunit; f | 88.78 | |
| 3nrb_A | 287 | Formyltetrahydrofolate deformylase; N-terminal ACT | 87.29 | |
| 2pc6_A | 165 | Probable acetolactate synthase isozyme III (small; | 84.91 | |
| 1y7p_A | 223 | Hypothetical protein AF1403; structural genomics, | 84.03 | |
| 2fgc_A | 193 | Acetolactate synthase, small subunit; regulatory s | 80.87 |
| >1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C | Back alignment and structure |
|---|
Probab=99.56 E-value=5.5e-15 Score=120.36 Aligned_cols=64 Identities=23% Similarity=0.435 Sum_probs=59.3
Q ss_pred hhhcchhHHHHHHHHHHHHHHHHHHccCCCCCCCCCCccchHHHHHHHHHHHHHHHHHHHHHHHH
Q 014477 210 SQRMTHIAVERNRRKQMNEHLRVLRSLMPGSYVQRGDQASIIGGAIEFVRELEQLLQCLESQKRR 274 (424)
Q Consensus 210 s~r~~H~~aER~RR~kmn~~f~~LrsLvP~~~~~K~dKaSIL~eAI~YIk~Lq~~v~~Le~ek~~ 274 (424)
.++.+|+.+||+||.+||++|..|++|||+. ..|++|++||.+||+||++|+.+++.|+.+...
T Consensus 5 ~rr~~H~~~ErrRR~~in~~f~~L~~lvP~~-~~k~~Ka~IL~~Ai~YI~~Lq~~~~~L~~e~~~ 68 (82)
T 1am9_A 5 EKRTAHNAIEKRYRSSINDKIIELKDLVVGT-EAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLS 68 (82)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHTCS-SCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHhhhhHHHHHHHHHHHHHHHHHHhccCC-CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 4678999999999999999999999999984 489999999999999999999999999987664
|
| >1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B | Back alignment and structure |
|---|
| >4h10_B Circadian locomoter output cycles protein kaput; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >4ati_A MITF, microphthalmia-associated transcription factor; DNA-binding protein-DNA complex, melanoma; 2.60A {Mus musculus} PDB: 4atk_A | Back alignment and structure |
|---|
| >1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >4h10_A ARYL hydrocarbon receptor nuclear translocator-LI 1; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3u5v_A Protein MAX, transcription factor E2-alpha chimer; basic helix-loop-helix (BHLH); 1.70A {Mus musculus} PDB: 2ql2_A* | Back alignment and structure |
|---|
| >1mdy_A Protein (MYOD BHLH domain); protein-DNA complex, transcription/DNA complex; HET: DNA; 2.80A {Mus musculus} SCOP: a.38.1.1 PDB: 1mdy_B* | Back alignment and structure |
|---|
| >2ql2_B Neurod1, neurogenic differentiation factor 1; basic-helix-loop-helix; HET: DNA; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} | Back alignment and structure |
|---|
| >4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} | Back alignment and structure |
|---|
| >2lfh_A DNA-binding protein inhibitor ID-3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ath_A MITF, microphthalmia-associated transcription factor; DNA binding protein, melanoma; HET: MSE; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >4aya_A DNA-binding protein inhibitor ID-2; cell cycle; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 | Back alignment and structure |
|---|
| >1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 | Back alignment and structure |
|---|
| >2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} | Back alignment and structure |
|---|
| >2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A | Back alignment and structure |
|---|
| >1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 | Back alignment and structure |
|---|
| >2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} | Back alignment and structure |
|---|
| >3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} | Back alignment and structure |
|---|
| >3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 | Back alignment and structure |
|---|
| >3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} | Back alignment and structure |
|---|
| >2pc6_A Probable acetolactate synthase isozyme III (small; regulatory subunit, structural genomi protein structure initiative; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6 | Back alignment and structure |
|---|
| >1y7p_A Hypothetical protein AF1403; structural genomics, protein structure initiative, PSI, alpha-beta-alpha sandwich; HET: RIP; 1.90A {Archaeoglobus fulgidus} SCOP: c.23.1.7 d.58.18.12 | Back alignment and structure |
|---|
| >2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomi protein structure initiative; 2.30A {Thermotoga maritima} SCOP: d.58.18.6 d.58.18.6 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 424 | ||||
| d1nkpb_ | 83 | a.38.1.1 (B:) Max protein {Human (Homo sapiens) [T | 2e-13 | |
| d1mdya_ | 68 | a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus muscul | 3e-13 | |
| d1nkpa_ | 88 | a.38.1.1 (A:) Myc proto-oncogene protein {Human (H | 2e-12 | |
| d1a0aa_ | 63 | a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Sa | 3e-11 | |
| d1nlwa_ | 79 | a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [T | 5e-11 | |
| d1am9a_ | 80 | a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxI | 8e-11 | |
| d1an4a_ | 65 | a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapien | 1e-10 | |
| d1uklc_ | 61 | a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId | 1e-09 |
| >d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: HLH-like superfamily: HLH, helix-loop-helix DNA-binding domain family: HLH, helix-loop-helix DNA-binding domain domain: Max protein species: Human (Homo sapiens) [TaxId: 9606]
Score = 63.0 bits (153), Expect = 2e-13
Identities = 14/64 (21%), Positives = 29/64 (45%)
Query: 211 QRMTHIAVERNRRKQMNEHLRVLRSLMPGSYVQRGDQASIIGGAIEFVRELEQLLQCLES 270
+R H A+ER RR + + LR +P ++ +A I+ A E+++ + + +
Sbjct: 2 KRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNHTHQQ 61
Query: 271 QKRR 274
Sbjct: 62 DIDD 65
|
| >d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 68 | Back information, alignment and structure |
|---|
| >d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 63 | Back information, alignment and structure |
|---|
| >d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
| >d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 61 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 424 | |||
| d1am9a_ | 80 | SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} | 99.49 | |
| d1mdya_ | 68 | Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10 | 99.49 | |
| d1nkpb_ | 83 | Max protein {Human (Homo sapiens) [TaxId: 9606]} | 99.46 | |
| d1nlwa_ | 79 | Mad protein {Human (Homo sapiens) [TaxId: 9606]} | 99.45 | |
| d1a0aa_ | 63 | Pho4 B/HLH domain {Baker's yeast (Saccharomyces ce | 99.41 | |
| d1nkpa_ | 88 | Myc proto-oncogene protein {Human (Homo sapiens) [ | 99.39 | |
| d1an4a_ | 65 | Usf B/HLH domain {Human (Homo sapiens) [TaxId: 960 | 99.29 | |
| d1uklc_ | 61 | SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} | 99.22 | |
| d1zpva1 | 83 | UPF0237 protein SP0238 {Streptococcus pneumoniae [ | 97.16 | |
| d1u8sa1 | 86 | putative transcriptional repressor VC2159 {Vibrio | 96.9 | |
| d1u8sa2 | 93 | putative transcriptional repressor VC2159 {Vibrio | 96.45 | |
| d1y7pa2 | 77 | Hypothetical protein AF1403, N-terminal domain {Ar | 94.83 | |
| d2f06a1 | 71 | Hypothetical protein BT0572 {Bacteroides thetaiota | 93.47 | |
| d2f06a2 | 70 | Hypothetical protein BT0572 {Bacteroides thetaiota | 92.26 | |
| d2fgca2 | 78 | Acetolactate synthase small subunit, IlvH {Thermot | 85.19 | |
| d1sc6a3 | 84 | Phosphoglycerate dehydrogenase, regulatory (C-term | 83.18 | |
| d2qmwa2 | 80 | Prephenate dehydratase C-terminal domain {Staphylo | 81.59 |
| >d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: HLH-like superfamily: HLH, helix-loop-helix DNA-binding domain family: HLH, helix-loop-helix DNA-binding domain domain: SREBP-1a species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.49 E-value=1.6e-14 Score=114.95 Aligned_cols=64 Identities=23% Similarity=0.435 Sum_probs=59.0
Q ss_pred hhhcchhHHHHHHHHHHHHHHHHHHccCCCCCCCCCCccchHHHHHHHHHHHHHHHHHHHHHHHH
Q 014477 210 SQRMTHIAVERNRRKQMNEHLRVLRSLMPGSYVQRGDQASIIGGAIEFVRELEQLLQCLESQKRR 274 (424)
Q Consensus 210 s~r~~H~~aER~RR~kmn~~f~~LrsLvP~~~~~K~dKaSIL~eAI~YIk~Lq~~v~~Le~ek~~ 274 (424)
.+|..|+.+||+||.+||+.|..|++|||.. ..|++|++||..||+||+.|+++++.|+.+...
T Consensus 5 ~kR~~H~~~Er~RR~~in~~~~~L~~llP~~-~~k~~K~~iL~~a~~yI~~L~~~~~~L~~e~~~ 68 (80)
T d1am9a_ 5 EKRTAHNAIEKRYRSSINDKIIELKDLVVGT-EAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLS 68 (80)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHTCS-SCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred hHHHHHHHHHHHHHHHHHHHHHHHHhcCCCC-CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 4678999999999999999999999999985 578999999999999999999999999887654
|
| >d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qmwa2 d.58.18.3 (A:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|