BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 014496
         (423 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3PQV|A Chain A, Cyclase Homolog
 pdb|3PQV|B Chain B, Cyclase Homolog
 pdb|3PQV|C Chain C, Cyclase Homolog
 pdb|3PQV|D Chain D, Cyclase Homolog
          Length = 365

 Score = 33.5 bits (75), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 13/23 (56%), Positives = 17/23 (73%)

Query: 59  FSTRIMLKPIDDPHVDMIATVSG 81
           F T I+LKP+DD   D+IAT+ G
Sbjct: 332 FGTEILLKPVDDNTTDLIATIKG 354


>pdb|1HJV|A Chain A, Crystal Structure Of Hcgp-39 In Complex With Chitin
           Tetramer
 pdb|1HJV|B Chain B, Crystal Structure Of Hcgp-39 In Complex With Chitin
           Tetramer
 pdb|1HJV|C Chain C, Crystal Structure Of Hcgp-39 In Complex With Chitin
           Tetramer
 pdb|1HJV|D Chain D, Crystal Structure Of Hcgp-39 In Complex With Chitin
           Tetramer
 pdb|1HJW|A Chain A, Crystal Structure Of Hcgp-39 In Complex With Chitin
           Octamer
 pdb|1HJW|B Chain B, Crystal Structure Of Hcgp-39 In Complex With Chitin
           Octamer
 pdb|1HJX|A Chain A, Ligand-Induced Signalling And Conformational Change Of The
           39 Kd Glycoprotein From Human Articular Chondrocytes
 pdb|1HJX|B Chain B, Ligand-Induced Signalling And Conformational Change Of The
           39 Kd Glycoprotein From Human Articular Chondrocytes
 pdb|1HJX|C Chain C, Ligand-Induced Signalling And Conformational Change Of The
           39 Kd Glycoprotein From Human Articular Chondrocytes
 pdb|1HJX|D Chain D, Ligand-Induced Signalling And Conformational Change Of The
           39 Kd Glycoprotein From Human Articular Chondrocytes
 pdb|1NWR|A Chain A, Crystal Structure Of Human Cartilage Gp39 (Hc-Gp39)
 pdb|1NWR|B Chain B, Crystal Structure Of Human Cartilage Gp39 (Hc-Gp39)
 pdb|1NWR|C Chain C, Crystal Structure Of Human Cartilage Gp39 (Hc-Gp39)
 pdb|1NWR|D Chain D, Crystal Structure Of Human Cartilage Gp39 (Hc-Gp39)
 pdb|1NWS|A Chain A, Crystal Structure Of Human Cartilage Gp39 (Hc-Gp39) In
           Complex With Chitobiose
 pdb|1NWS|B Chain B, Crystal Structure Of Human Cartilage Gp39 (Hc-Gp39) In
           Complex With Chitobiose
 pdb|1NWS|C Chain C, Crystal Structure Of Human Cartilage Gp39 (Hc-Gp39) In
           Complex With Chitobiose
 pdb|1NWS|D Chain D, Crystal Structure Of Human Cartilage Gp39 (Hc-Gp39) In
           Complex With Chitobiose
 pdb|1NWT|A Chain A, Crystal Structure Of Human Cartilage Gp39 (Hc-Gp39) In
           Complex With Chitopentaose
 pdb|1NWT|B Chain B, Crystal Structure Of Human Cartilage Gp39 (Hc-Gp39) In
           Complex With Chitopentaose
 pdb|1NWT|C Chain C, Crystal Structure Of Human Cartilage Gp39 (Hc-Gp39) In
           Complex With Chitopentaose
 pdb|1NWT|D Chain D, Crystal Structure Of Human Cartilage Gp39 (Hc-Gp39) In
           Complex With Chitopentaose
 pdb|1NWU|A Chain A, Crystal Structure Of Human Cartilage Gp39 (Hc-Gp39) In
           Complex With Chitotetraose
 pdb|1NWU|B Chain B, Crystal Structure Of Human Cartilage Gp39 (Hc-Gp39) In
           Complex With Chitotetraose
 pdb|1NWU|C Chain C, Crystal Structure Of Human Cartilage Gp39 (Hc-Gp39) In
           Complex With Chitotetraose
 pdb|1NWU|D Chain D, Crystal Structure Of Human Cartilage Gp39 (Hc-Gp39) In
           Complex With Chitotetraose
          Length = 362

 Score = 31.6 bits (70), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 7/65 (10%)

Query: 192 RLTVGVQYEPQYGGKEDAKYKNLMNWSYAIGYGVGSGSPLS------PSFNFGLELAKSS 245
           R T G  + P + G+EDA      N  YA+GY +  G+P S      P+F     LA S 
Sbjct: 192 RGTTG-HHSPLFRGQEDASPDRFSNTDYAVGYMLRLGAPASKLVMGIPTFGRSFTLASSE 250

Query: 246 VFIAS 250
             + +
Sbjct: 251 TGVGA 255


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.319    0.136    0.412 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 12,781,757
Number of Sequences: 62578
Number of extensions: 543600
Number of successful extensions: 1143
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1140
Number of HSP's gapped (non-prelim): 4
length of query: 423
length of database: 14,973,337
effective HSP length: 101
effective length of query: 322
effective length of database: 8,652,959
effective search space: 2786252798
effective search space used: 2786252798
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (25.0 bits)