Citrus Sinensis ID: 014513

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420---

MATAGPQGGGYHQHHHPMTLEEVRTLWIGDLQYWFDENYLSSCFAHTGEVVSIKIIRNKITGQPEGYGFVEFVSHAAAERVLQTYNGTPMPGTEQNFRLNWASFGIGEKRPDAGPEHSIFVGDLAPDVTDYLLQETFRSQYPSVRGAKVVTDPNTGRSKGYGFVKFLDENERNRAMTEMNGVFCSTRPMRISAATPKKTTGFQQQYAAVKATYPVAAYTTPVQVFPADNDITNTTIFVGNLDPNVTEEELKQTFLHFGEIVNVKIPMGRGCGFVQFAARASAEEAILRMQGHMIGQQQVRISWGRKQDVTGSVAAQVDPSQWNAYYGYGQGYDAYAYGAAQDPSLYAYGAYAGYPQYAQQAEGVTDMAAVASALPTMEQREELYDPLATPDVDKLNAAYLSIHGNAILGRTLWLKTSSLTPQT

ccccccccccccccccccccccccEEEEccccccccHHHHHHHHccccccEEEEEEccccccccccEEEEEcccHHHHHHHHHHHcccccccccccEEEEcccccccccccccccccEEEEccccccccHHHHHHHHHcccccccccEEEEcccccccccEEEEEEccHHHHHHHHHHHcccccccccEEECcccccccccHHHHHHHHHccccccccccccccccccccccccEEEEccccccccHHHHHHHHcccccEEEEEEEccccEEEEEcccHHHHHHHHHHHcccEEccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccc

*********************EVRTLWIGDLQYWFDENYLSSCFAHTGEVVSIKIIRNKITGQPEGYGFVEFVSHAAAERVLQTYNGTPMPGTEQNFRLNWASFG**********EHSIFVGDLAPDVTDYLLQETFRSQYPSVRGAKVVTDPNTGRSKGYGFVKFLDENERNRAMTEMNGVFCSTRPMRIS*****KT***QQQYAAVKAT**VAAYTTPVQVFPADNDITNTTIFVGNLDPNVTEEELKQTFLHFGEIVNVKIPMGRGCGFVQFAARASAEEAILRMQGHMIGQQQVRISWGRKQDVTGSVAAQVDPSQWNAYYGYGQGYDAYAYGAAQDPSLYAYGAYAGYPQYAQQAEGVTDMAAVASAL*******ELYDPLATPDVDKLNAAYLSIHGNAILGRTL***********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Polyadenylate-binding protein RBP47B'	Heterogeneous nuclear ribonucleoprotein (hnRNP)-protein binding the poly(A) tail of mRNA and probably involved in some steps of pre-mRNA maturation.	confident	Q8VXZ9

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1L3K, chain A
Confidence level:very confident
Coverage over the Query: 111-196,232-305
View the alignment between query and template
View the model in PyMOL

Template: 4F02, chain A
Confidence level:very confident
Coverage over the Query: 23-199
View the alignment between query and template
View the model in PyMOL

Template: 2ADC, chain A
Confidence level:very confident
Coverage over the Query: 112-307
View the alignment between query and template
View the model in PyMOL