BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 014518
         (423 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2IA4|A Chain A, Crystal Structure Of Novel Amino Acid Binding Protein From
           Shigella Flexneri
 pdb|2IA4|B Chain B, Crystal Structure Of Novel Amino Acid Binding Protein From
           Shigella Flexneri
          Length = 287

 Score = 28.9 bits (63), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 23/51 (45%)

Query: 36  GSISPVIKSSLNYNQKQIARLGVAKDLGDSVGFLAGSLCEVLPIWGALLVG 86
           G+ S V+ + LN  QK   R+  AKD GDS   L            ALL G
Sbjct: 138 GTTSEVLLNKLNEEQKXNXRIISAKDHGDSFRTLESGRAVAFXXDDALLAG 188


>pdb|1PWX|A Chain A, Crystal Structure Of The Haloalcohol Dehalogenase Hhec
           Complexed With Bromide
 pdb|1PWX|B Chain B, Crystal Structure Of The Haloalcohol Dehalogenase Hhec
           Complexed With Bromide
 pdb|1PWX|C Chain C, Crystal Structure Of The Haloalcohol Dehalogenase Hhec
           Complexed With Bromide
 pdb|1PWX|D Chain D, Crystal Structure Of The Haloalcohol Dehalogenase Hhec
           Complexed With Bromide
 pdb|1PWZ|A Chain A, Crystal Structure Of The Haloalcohol Dehalogenase Hhec
           Complexed With (R)-Styrene Oxide And Chloride
 pdb|1PWZ|B Chain B, Crystal Structure Of The Haloalcohol Dehalogenase Hhec
           Complexed With (R)-Styrene Oxide And Chloride
 pdb|1PX0|A Chain A, Crystal Structure Of The Haloalcohol Dehalogenase Hhec
           Complexed With The Haloalcohol Mimic (R)-1-Para-Nitro-
           Phenyl-2-Azido-Ethanol
 pdb|1PX0|B Chain B, Crystal Structure Of The Haloalcohol Dehalogenase Hhec
           Complexed With The Haloalcohol Mimic (R)-1-Para-Nitro-
           Phenyl-2-Azido-Ethanol
 pdb|1PX0|C Chain C, Crystal Structure Of The Haloalcohol Dehalogenase Hhec
           Complexed With The Haloalcohol Mimic (R)-1-Para-Nitro-
           Phenyl-2-Azido-Ethanol
 pdb|1PX0|D Chain D, Crystal Structure Of The Haloalcohol Dehalogenase Hhec
           Complexed With The Haloalcohol Mimic (R)-1-Para-Nitro-
           Phenyl-2-Azido-Ethanol
 pdb|1ZMT|A Chain A, Structure Of Haloalcohol Dehalogenase Hhec Of
           Agrobacterium Radiobacter Ad1 In Complex With
           (R)-Para-Nitro Styrene Oxide, With A Water Molecule In
           The Halide-Binding Site
 pdb|1ZMT|B Chain B, Structure Of Haloalcohol Dehalogenase Hhec Of
           Agrobacterium Radiobacter Ad1 In Complex With
           (R)-Para-Nitro Styrene Oxide, With A Water Molecule In
           The Halide-Binding Site
 pdb|1ZMT|C Chain C, Structure Of Haloalcohol Dehalogenase Hhec Of
           Agrobacterium Radiobacter Ad1 In Complex With
           (R)-Para-Nitro Styrene Oxide, With A Water Molecule In
           The Halide-Binding Site
 pdb|1ZMT|D Chain D, Structure Of Haloalcohol Dehalogenase Hhec Of
           Agrobacterium Radiobacter Ad1 In Complex With
           (R)-Para-Nitro Styrene Oxide, With A Water Molecule In
           The Halide-Binding Site
 pdb|1ZO8|A Chain A, X-Ray Structure Of The Haloalcohol Dehalogenase Hhec Of
           Agrobacterium Radiobacter Ad1 In Complex With (S)-Para-
           Nitrostyrene Oxide, With A Water Molecule In The Halide-
           Binding Site
 pdb|1ZO8|B Chain B, X-Ray Structure Of The Haloalcohol Dehalogenase Hhec Of
           Agrobacterium Radiobacter Ad1 In Complex With (S)-Para-
           Nitrostyrene Oxide, With A Water Molecule In The Halide-
           Binding Site
 pdb|1ZO8|C Chain C, X-Ray Structure Of The Haloalcohol Dehalogenase Hhec Of
           Agrobacterium Radiobacter Ad1 In Complex With (S)-Para-
           Nitrostyrene Oxide, With A Water Molecule In The Halide-
           Binding Site
 pdb|1ZO8|D Chain D, X-Ray Structure Of The Haloalcohol Dehalogenase Hhec Of
           Agrobacterium Radiobacter Ad1 In Complex With (S)-Para-
           Nitrostyrene Oxide, With A Water Molecule In The Halide-
           Binding Site
 pdb|1ZO8|E Chain E, X-Ray Structure Of The Haloalcohol Dehalogenase Hhec Of
           Agrobacterium Radiobacter Ad1 In Complex With (S)-Para-
           Nitrostyrene Oxide, With A Water Molecule In The Halide-
           Binding Site
 pdb|1ZO8|F Chain F, X-Ray Structure Of The Haloalcohol Dehalogenase Hhec Of
           Agrobacterium Radiobacter Ad1 In Complex With (S)-Para-
           Nitrostyrene Oxide, With A Water Molecule In The Halide-
           Binding Site
 pdb|1ZO8|G Chain G, X-Ray Structure Of The Haloalcohol Dehalogenase Hhec Of
           Agrobacterium Radiobacter Ad1 In Complex With (S)-Para-
           Nitrostyrene Oxide, With A Water Molecule In The Halide-
           Binding Site
 pdb|1ZO8|H Chain H, X-Ray Structure Of The Haloalcohol Dehalogenase Hhec Of
           Agrobacterium Radiobacter Ad1 In Complex With (S)-Para-
           Nitrostyrene Oxide, With A Water Molecule In The Halide-
           Binding Site
 pdb|1ZO8|I Chain I, X-Ray Structure Of The Haloalcohol Dehalogenase Hhec Of
           Agrobacterium Radiobacter Ad1 In Complex With (S)-Para-
           Nitrostyrene Oxide, With A Water Molecule In The Halide-
           Binding Site
 pdb|1ZO8|J Chain J, X-Ray Structure Of The Haloalcohol Dehalogenase Hhec Of
           Agrobacterium Radiobacter Ad1 In Complex With (S)-Para-
           Nitrostyrene Oxide, With A Water Molecule In The Halide-
           Binding Site
 pdb|1ZO8|K Chain K, X-Ray Structure Of The Haloalcohol Dehalogenase Hhec Of
           Agrobacterium Radiobacter Ad1 In Complex With (S)-Para-
           Nitrostyrene Oxide, With A Water Molecule In The Halide-
           Binding Site
 pdb|1ZO8|L Chain L, X-Ray Structure Of The Haloalcohol Dehalogenase Hhec Of
           Agrobacterium Radiobacter Ad1 In Complex With (S)-Para-
           Nitrostyrene Oxide, With A Water Molecule In The Halide-
           Binding Site
 pdb|1ZO8|M Chain M, X-Ray Structure Of The Haloalcohol Dehalogenase Hhec Of
           Agrobacterium Radiobacter Ad1 In Complex With (S)-Para-
           Nitrostyrene Oxide, With A Water Molecule In The Halide-
           Binding Site
 pdb|1ZO8|N Chain N, X-Ray Structure Of The Haloalcohol Dehalogenase Hhec Of
           Agrobacterium Radiobacter Ad1 In Complex With (S)-Para-
           Nitrostyrene Oxide, With A Water Molecule In The Halide-
           Binding Site
 pdb|1ZO8|O Chain O, X-Ray Structure Of The Haloalcohol Dehalogenase Hhec Of
           Agrobacterium Radiobacter Ad1 In Complex With (S)-Para-
           Nitrostyrene Oxide, With A Water Molecule In The Halide-
           Binding Site
 pdb|1ZO8|P Chain P, X-Ray Structure Of The Haloalcohol Dehalogenase Hhec Of
           Agrobacterium Radiobacter Ad1 In Complex With (S)-Para-
           Nitrostyrene Oxide, With A Water Molecule In The Halide-
           Binding Site
          Length = 254

 Score = 28.9 bits (63), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 16/25 (64%)

Query: 53  IARLGVAKDLGDSVGFLAGSLCEVL 77
           + RLG  K+LG+ V FLA   C+ L
Sbjct: 208 LQRLGTQKELGELVAFLASGSCDYL 232


>pdb|2VHA|A Chain A, Debp
 pdb|2VHA|B Chain B, Debp
          Length = 287

 Score = 28.9 bits (63), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 24/51 (47%)

Query: 36  GSISPVIKSSLNYNQKQIARLGVAKDLGDSVGFLAGSLCEVLPIWGALLVG 86
           G+ S V+ + LN  QK   R+  AKD GDS   L         +  ALL G
Sbjct: 138 GTTSEVLLNKLNEEQKMNMRIISAKDHGDSFRTLESGRAVAFMMDDALLAG 188


>pdb|2UZF|A Chain A, Crystal Structure Of Staphylococcus Aureus
           1,4-Dihydroxy-2- Naphthoyl Coa Synthase (Menb) In
           Complex With Acetoacetyl Coa
 pdb|2UZF|B Chain B, Crystal Structure Of Staphylococcus Aureus
           1,4-Dihydroxy-2- Naphthoyl Coa Synthase (Menb) In
           Complex With Acetoacetyl Coa
          Length = 273

 Score = 28.5 bits (62), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 3/57 (5%)

Query: 118 FVGNNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLGGAILTQVYTMIHAPDHA 174
           +VG +     N   L   ++  PK   PV+ ++KG+A  GG +L  V  +  A D+A
Sbjct: 85  YVGEDQIPRLNVLDLQRLIRIIPK---PVIAMVKGYAVGGGNVLNVVCDLTIAADNA 138


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.141    0.432 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,240,347
Number of Sequences: 62578
Number of extensions: 417491
Number of successful extensions: 1110
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1106
Number of HSP's gapped (non-prelim): 5
length of query: 423
length of database: 14,973,337
effective HSP length: 101
effective length of query: 322
effective length of database: 8,652,959
effective search space: 2786252798
effective search space used: 2786252798
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 53 (25.0 bits)