BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 014536
         (423 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2PMS|C Chain C, Crystal Structure Of The Complex Of Human Lactoferrin
           N-Lobe And Lactoferrin-Binding Domain Of Pneumococcal
           Surface Protein A
 pdb|2PMS|D Chain D, Crystal Structure Of The Complex Of Human Lactoferrin
           N-Lobe And Lactoferrin-Binding Domain Of Pneumococcal
           Surface Protein A
          Length = 125

 Score = 28.5 bits (62), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 33/61 (54%), Gaps = 2/61 (3%)

Query: 280 IKRKFSIQKALLSKADRSS--IDRLRQQIYNLEKQQRRLEEDVYVYNWLQDQLRLSPACK 337
           ++ K   +KA LSK +  S  ID L  +I  LE Q +  EE+  V ++ ++ L  + A K
Sbjct: 49  LQSKLDAKKAKLSKLEELSDKIDELDAEIAKLEDQLKAAEENNNVEDYFKEGLEKTIAAK 108

Query: 338 K 338
           K
Sbjct: 109 K 109


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.317    0.131    0.385 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,073,781
Number of Sequences: 62578
Number of extensions: 312228
Number of successful extensions: 912
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 909
Number of HSP's gapped (non-prelim): 7
length of query: 423
length of database: 14,973,337
effective HSP length: 101
effective length of query: 322
effective length of database: 8,652,959
effective search space: 2786252798
effective search space used: 2786252798
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)