BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 014542
         (423 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2VTW|A Chain A, Structure Of The C-Terminal Head Domain Of The Fowl
           Adenovirus Type 1 Short Fibre
 pdb|2VTW|B Chain B, Structure Of The C-Terminal Head Domain Of The Fowl
           Adenovirus Type 1 Short Fibre
 pdb|2VTW|C Chain C, Structure Of The C-Terminal Head Domain Of The Fowl
           Adenovirus Type 1 Short Fibre
 pdb|2VTW|D Chain D, Structure Of The C-Terminal Head Domain Of The Fowl
           Adenovirus Type 1 Short Fibre
 pdb|2VTW|E Chain E, Structure Of The C-Terminal Head Domain Of The Fowl
           Adenovirus Type 1 Short Fibre
 pdb|2VTW|F Chain F, Structure Of The C-Terminal Head Domain Of The Fowl
           Adenovirus Type 1 Short Fibre
          Length = 205

 Score = 29.3 bits (64), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 17/46 (36%)

Query: 373 DLECFKFDKNGQVGHNETYFAEWARSILNQVRISKLEQATRNRSNL 418
           D         G V  N  YF  W  S L Q   S + Q T   SN+
Sbjct: 53  DTTTMGTRPTGAVNENARYFTVWVSSFLTQCNPSNIGQGTLEPSNI 98


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.321    0.133    0.427 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 12,547,567
Number of Sequences: 62578
Number of extensions: 506164
Number of successful extensions: 942
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 941
Number of HSP's gapped (non-prelim): 1
length of query: 423
length of database: 14,973,337
effective HSP length: 101
effective length of query: 322
effective length of database: 8,652,959
effective search space: 2786252798
effective search space used: 2786252798
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 53 (25.0 bits)