BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 014542
(423 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2VTW|A Chain A, Structure Of The C-Terminal Head Domain Of The Fowl
Adenovirus Type 1 Short Fibre
pdb|2VTW|B Chain B, Structure Of The C-Terminal Head Domain Of The Fowl
Adenovirus Type 1 Short Fibre
pdb|2VTW|C Chain C, Structure Of The C-Terminal Head Domain Of The Fowl
Adenovirus Type 1 Short Fibre
pdb|2VTW|D Chain D, Structure Of The C-Terminal Head Domain Of The Fowl
Adenovirus Type 1 Short Fibre
pdb|2VTW|E Chain E, Structure Of The C-Terminal Head Domain Of The Fowl
Adenovirus Type 1 Short Fibre
pdb|2VTW|F Chain F, Structure Of The C-Terminal Head Domain Of The Fowl
Adenovirus Type 1 Short Fibre
Length = 205
Score = 29.3 bits (64), Expect = 4.0, Method: Compositional matrix adjust.
Identities = 15/46 (32%), Positives = 17/46 (36%)
Query: 373 DLECFKFDKNGQVGHNETYFAEWARSILNQVRISKLEQATRNRSNL 418
D G V N YF W S L Q S + Q T SN+
Sbjct: 53 DTTTMGTRPTGAVNENARYFTVWVSSFLTQCNPSNIGQGTLEPSNI 98
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.321 0.133 0.427
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 12,547,567
Number of Sequences: 62578
Number of extensions: 506164
Number of successful extensions: 942
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 941
Number of HSP's gapped (non-prelim): 1
length of query: 423
length of database: 14,973,337
effective HSP length: 101
effective length of query: 322
effective length of database: 8,652,959
effective search space: 2786252798
effective search space used: 2786252798
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 53 (25.0 bits)