Citrus Sinensis ID: 014544


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420---
MERIIGVKYKLGRKIGSGSFGEIFLASHVDTNEIVAVKIENSGTKHPQLLYEAKVYKILQGGSGIPNIKWYGVDGEDNVLVLDLLGPSLEDLFVYCRRKFSLKTVLMLADQMIARIEYVHSRGFLHRDIKPDNFLMGLGRKANQVYIIDFGLAKKYRDPTTNRHIPYRENKNLTGTARYASCNTHLGIEQSRRDDLESLGYVLLYFLRGSLPWQGLKAATKKQKYDKICEKKVSTPIEVLCKSHPAEFASYFHYCQSLTFDQRPDYGFLKRLFHDLFSREGYDFDFVFDWTILKYQQTQKTKSQDLLPASRVTNSRVMPMRTDKLKGVNDASCSAEVLECRGSYNRTRPDADMQHRPSVAEKMSSDHHFGKHSMGNASIPSASFVLPSTFNRNFQKPEGPDEAANIGRGHGNKTGASSSWMPL
cccEEccEEEEEEEEcccccEEEEEEEEEccccEEEEcccccccccccHHHHHHHHHHHcccccccCEEEcccccccEEEEEEcccccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccccccccccEEECccccccEEEEEEcccccEEEccccccccccccccccCECcccHHHcccccccccccHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHcccHHHHcccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
MERIIGVKYKLGRKIGSGSFGEIFLASHVDTNEIVAVKIENSGTKHPQLLYEAKVYKILQGGSGIPNIKWYGVDGEDNVLVLDLLGPSLEDLFVYCRRKFSLKTVLMLADQMIARIEYVHSRGFLHRDIKPDNFLMGLGRKANQVYIIDFGLAKKYRDPTTNRHIPYRENKNLTGTARYASCNTHLGIEQSRRDDLESLGYVLLYFLRGSLPWQGLKAATKKQKYDKICEKKVSTPIEVLCKSHPAEFASYFHYCQSLTFDQRPDYGFLKRLFHDLFSREGYDFDFVFDWTILKYQ*******************************************************************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MERIIGVKYKLGRKIGSGSFGEIFLASHVDTNEIVAVKIENSGTKHPQLLYEAKVYKILQGGSGIPNIKWYGVDGEDNVLVLDLLGPSLEDLFVYCRRKFSLKTVLMLADQMIARIEYVHSRGFLHRDIKPDNFLMGLGRKANQVYIIDFGLAKKYRDPTTNRHIPYRENKNLTGTARYASCNTHLGIEQSRRDDLESLGYVLLYFLRGSLPWQGLKAATKKQKYDKICEKKVSTPIEVLCKSHPAEFASYFHYCQSLTFDQRPDYGFLKRLFHDLFSREGYDFDFVFDWTILKYQQTQKTKSQDLLPASRVTNSRVMPMRTDKLKGVNDASCSAEVLECRGSYNRTRPDADMQHRPSVAEKMSSDHHFGKHSMGNASIPSASFVLPSTFNRNFQKPEGPDEAANIGRGHGNKTGASSSWMPL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Casein kinase I isoform delta Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. Central component of the circadian clock. May act as a negative regulator of circadian rhythmicity by phosphorylating per1 and per2, which may lead to their degradation. Participates in wnt signaling.probableQ6P647
Casein kinase I Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins.probableQ8IHZ9
Casein kinase I Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. Can phosphorylate a large number of proteins. May have a role in DNA repair mechanism and support vegetative growth of the cells.probableQ556Y4

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable
2.7.11.1Transferred entry: 2.7.11.19.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SV0, chain A
Confidence level:very confident
Coverage over the Query: 2-295
View the alignment between query and template
View the model in PyMOL
Template: 3NPC, chain A
Confidence level:probable
Coverage over the Query: 76-278,289-331
View the alignment between query and template
View the model in PyMOL