Citrus Sinensis ID: 014580


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420--
MRKVNWAIALHLGALRQLESSSSISHRNPLLHQRWFVQRAAATPSLSNFRSYSTEMLSNDLIKIMEQRVLAIERRSACLENLVNQPEASPAEYSKANKELRKLRDSMHLISELRTKQKEIDGLKSLIYECSEDKDMLDMATEELCLAIDEEKRLQSLLLKSLLPKDDADERDCILEVRAGTGGEEASLFAVDVFKMYERYSQKKGWKFEVVGVTESDLRGYKEASAAISGVGVYGKLKFESGIHRVQRVPLTEKSGRVHTSAVSVAILPQADEVDVRLRNEDLRIDTYRSGGSGGQHANTTNSAVRVTHIPTGMTISIQDERSQHMNKAKALKVLCAKLYEMERSRIHLSRSKLRSEQIGSGDRSERIRTYNFPQGRVTDHRVGITHHAISDMMEGENLDIFIDALLLQQEMDAIASFGSTQ
ccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHcccEEEEEEccccccccEEEEEEEEECcccccccccccccccccccccccccccccccccEEEEcccccccccccccccCEEEEEccccccccccccccccEEcccccccEEEEEccccHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHccccccHHHHHHHHHHHHHHHHHHccccc
***VNWAIALHLGALRQ*************LHQRWFVQRAAATPSLSNFRSYSTEMLSNDLIKIMEQRVLAIERRSACLENL****************ELRKLRDSMHLISELRTKQKEIDGLKSLIYECSEDKDMLDMATEELCLAIDEEKRLQSLLLKSLLPKDDADERDCILEVRAGTGGEEASLFAVDVFKMYERYSQKKGWKFEVVGVTESDLRGYKEASAAISGVGVYGKLKFESGIHRVQRVPLTEKSGRVHTSAVSVAILPQADEVDVRLRNEDLRIDTYRSGGSGGQHANTTNSAVRVTHIPTGMTISIQDERS**MNKAKALKVLCAKLYEM************************RIRTYNFPQGRVTDHRVGITHHAISDMMEGENLDIFIDALLLQQEMD**A******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRKVNWAIALHLGALRQLESSSSISHRNPLLHQRWFVQRAAATPSLSNFRSYSTEMLSNDLIKIMEQRVLAIERRSACLENLVNQPEASPAEYSKANKELRKLRDSMHLISELRTKQKEIDGLKSLIYECSEDKDMLDMATEELCLAIDEEKRLQSLLLKSLLPKDDADERDCILEVRAGTGGEEASLFAVDVFKMYERYSQKKGWKFEVVGVTESDLRGYKEASAAISGVGVYGKLKFESGIHRVQRVPLTEKSGRVHTSAVSVAILPQADEVDVRLRNEDLRIDTYRSGGSGGQHANTTNSAVRVTHIPTGMTISIQDERSQHMNKAKALKVLCAKLYEMERSRIHLSRSKLRSEQIGSGDRSERIRTYNFPQGRVTDHRVGITHHAISDMMEGENLDIFIDALLLQQEMDAIASFGSTQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peptide chain release factor 1 Peptide chain release factor 1 directs the termination of translation in response to the peptide chain termination codons UAG and UAA.probableB3CL87
Peptide chain release factor 1 Peptide chain release factor 1 directs the termination of translation in response to the peptide chain termination codons UAG and UAA.probableQ5PAH2
Peptide chain release factor 1 Peptide chain release factor 1 directs the termination of translation in response to the peptide chain termination codons UAG and UAA.probableB9KIV2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2B3T, chain B
Confidence level:very confident
Coverage over the Query: 67-127,163-416
View the alignment between query and template
View the model in PyMOL