Citrus Sinensis ID: 014609


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-
MVIAEKKQEGMRLGRYELGRTLGEGNFGKVKFAQDLDSGLPFAVKILEKNRIIHLKITDQIKREIATLKLLKHPNVVRLHEVLASKSKIYMVLEYVTGGELFDKIASKGRLQEAEGRKLFQQLIDGVSYCHNKGVFHRDLKLENILLDSKGNIKISDFGLSALPQHFRDDGLLHTTCGSPNYVAPEVLANRGYDGATSDIWSCGVILYIFRGDFKLPKWLSPGAQNLLRKILEPNPVKRITIAGIKADEWFEQDYTPANPDDDEEDIFVDNEAFSMHEVPSDGGRTPGSPPLINAFQLIGMSSCLDLSGFFEKEDVSERKIRFTSNHSAKDLLERIEDIVTEMGFRVQKKNGKLKATQEHKPQKSLGSLSVAAEVFEISPSLYVVELRKSYGDPTVYRQLCNKLSSDLGLPPSQELLATEV
cccccccccccCEEcEEEEEEEEccccCEEEEEEEcccccEEEEEEEEccccccccHHHHHHHHHHHHHHcccccEEEEEEEEEcccEEEEEEEEcccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEECcccccccccccccccCEEccccccccccHHHcccccccccccccccccEEEEEEEccccccccccHHHHHHHHHHccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHcccEEEEEccEEEEEEccccccccccEEEEEEEEEEcccEEEEEEEEccccHHHHHHHHHHHHHHcccccccccccccc
*************GRYELGRTLGEGNFGKVKFAQDLDSGLPFAVKILEKNRIIHLKITDQIKREIATLKLLKHPNVVRLHEVLASKSKIYMVLEYVTGGELFDKIASKGRLQEAEGRKLFQQLIDGVSYCHNKGVFHRDLKLENILLDSKGNIKISDFGLSALPQHFRDDGLLHTTCGSPNYVAPEVLANRGYDGATSDIWSCGVILYIFRGDFKLPKWLSPGAQNLLRKILEPNPVKRITIAGIKADEWFEQDYTPA*********************************LINAFQLIGMSSCLDLSGFFEKEDVSERKIRFT****AKDLLERIEDIVTEMGFRVQ********************LSVAAEVFEISPSLYVVELRKSYGDPTVYRQLCNKLSSDLGLPPSQELLATEV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVIAEKKQEGMRLGRYELGRTLGEGNFGKVKFAQDLDSGLPFAVKILEKNRIIHLKITDQIKREIATLKLLKHPNVVRLHEVLASKSKIYMVLEYVTGGELFDKIASKGRLQEAEGRKLFQQLIDGVSYCHNKGVFHRDLKLENILLDSKGNIKISDFGLSALPQHFRDDGLLHTTCGSPNYVAPEVLANRGYDGATSDIWSCGVILYIFRGDFKLPKWLSPGAQNLLRKILEPNPVKRITIAGIKADEWFEQDYTPANPDDDEEDIFVDNEAFSMHEVPSDGGRTPGSPPLINAFQLIGMSSCLDLSGFFEKEDVSERKIRFTSNHSAKDLLERIEDIVTEMGFRVQKKNGKLKATQEHKPQKSLGSLSVAAEVFEISPSLYVVELRKSYGDPTVYRQLCNKLSSDLGLPPSQELLATEV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
CBL-interacting protein kinase 1 CIPK serine-threonine protein kinases interact with CBL proteins. Binding of a CBL protein to the regulatory NAF domain of CIPK protein lead to the activation of the kinase in a calcium-dependent manner.probableQ9LGV5
CBL-interacting serine/threonine-protein kinase 1 CIPK serine-threonine protein kinases interact with CBL proteins. Binding of a CBL protein to the regulatory NAF domain of CIPK protein lead to the activation of the kinase in a calcium-dependent manner.probableQ8RWC9
CBL-interacting protein kinase 21 CIPK serine-threonine protein kinases interact with CBL proteins. Binding of a CBL protein to the regulatory NAF domain of CIPK protein lead to the activation of the kinase in a calcium-dependent manner.probableQ0D4B2

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable
2.7.11.1Transferred entry: 2.7.11.19.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2H6D, chain A
Confidence level:very confident
Coverage over the Query: 10-166,183-255
View the alignment between query and template
View the model in PyMOL
Template: 2EHB, chain D
Confidence level:very confident
Coverage over the Query: 289-414
View the alignment between query and template
View the model in PyMOL
Template: 1ZMU, chain A
Confidence level:confident
Coverage over the Query: 14-156,178-270
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
2y94, chain Avery confident Alignment | Template Structure