Citrus Sinensis ID: 014610


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-
MADLAGLQEAAGSRFSSLELIGRGSFGDVYKAFDKELNKDVAIKVIDLEESEDEIEDIQKEISVLSQCRSPYITEYYGSYLHQTKLWIIMEYMAGGSVADLIQSGPPLDEMSIACILRDLLHAIEYLHNEGKIHRDIKAANILLTENGDVKVADFGVSAQLTRTISRRKTFVGTPFWMAPEVIQNSEGYNEKADIWSLGITVIEMAKGEPPLADLHPMRVLFIIPRENPPQLDEHFSRLMKEFVSLCLKKVPAERPSAKELLRHRFIRNARKSPRLLERIRERPKYPIQEEPDTPINGVRAVGEASGTVKVVRDKRSEETVQVSSQGQTVRNAGWNFSLSESHGTGTIRTAVKPPQVREKKPEFSYNQYTPKRTAERSNHGFSASGSTLHESPDASPTRYARDSYFDDRQDDYYEDVSFFL
cccccccccccccccEEEEEECccccCEEEEEEEcccccEEEEEEEccccccHHHHHHHHHHHHHHHcccccccCEEEEEECccEEEEEEEccccccHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccccccccccccEEEcccccEEEccccHHHccccccccccccccccccccHHHHccccccccccHHHHHHHHHHHHHccccccccccHHHHHHHccccccccccccccHHHHHHHHHHHcccccccccHHHHHcccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
************SRFSSLELIGRGSFGDVYKAFDKELNKDVAIKVIDLEESEDEIEDIQKEISVLSQCRSPYITEYYGSYLHQTKLWIIMEYMAGGSVADLIQSGPPLDEMSIACILRDLLHAIEYLHNEGKIHRDIKAANILLTENGDVKVADFGVSAQLTRTISRRKTFVGTPFWMAPEVIQNSEGYNEKADIWSLGITVIEMAKGEPPLADLHPMRVLFIIPRENPPQLDEHFSRLMKEFVSLCLKKVPAERPSAKELLRHRFIRNARKSPRLLERIR****************************************************************************************************************************************SFFL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADLAGLQEAAGSRFSSLELIGRGSFGDVYKAFDKELNKDxxxxxxxxxxxxxxxxxxxxxxxxxxxxRSPYITEYYGSYLHQTKLWIIMEYMAGGSVADLIQSGPPLDEMSIACILRDLLHAIEYLHNEGKIHRDIKAANILLTENGDVKVADFGVSAQLTRTISRRKTFVGTPFWMAPEVIQNSEGYNEKADIWSLGITVIEMAKGEPPLADLHPMRVLFIIPRENPPQLDEHFSRLMKEFVSLCLKKVPAERPSAKELLRHRFIRNARKSPRLLERIRERPKYPIQEEPDTPINGVRAVGEASGTVKVVRDKRSEETVQVSSQGQTVRNAGWNFSLSESHGTGTIRTAVKPPQVREKKPEFSYNQYTPKRTAERSNHGFSASGSTLHESPDASPTRYARDSYFDDRQDDYYEDVSFFL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/threonine-protein kinase 24 Serine/threonine-protein kinase that acts on both serine and threonine residues and promotes apoptosis in response to stress stimuli and caspase activation. Mediates oxidative-stress-induced cell death by modulating phosphorylation of JNK1-JNK2 (MAPK8 and MAPK9), p38 (MAPK11, MAPK12, MAPK13 and MAPK14) during oxidative stress. Plays a role in a staurosporine-induced caspase-independent apoptotic pathway by regulating the nuclear translocation of AIFM1 and ENDOG and the DNase activity associated with ENDOG. Phosphorylates STK38L on 'Thr-442' and stimulates its kinase activity. Regulates cellular migration with alteration of PTPN12 activity and PXN phosphorylation: phosphorylates PTPN12 and inhibits its activity and may regulate PXN phosphorylation through PTPN12. Acts as a key regulator of axon regeneration in the optic nerve and radial nerve.probableQ99KH8
Serine/threonine-protein kinase 24 Serine/threonine-protein kinase that acts on both serine and threonine residues and promotes apoptosis in response to stress stimuli and caspase activation. Mediates oxidative-stress-induced cell death by modulating phosphorylation of JNK1-JNK2 (MAPK8 and MAPK9), p38 (MAPK11, MAPK12, MAPK13 and MAPK14) during oxidative stress. Plays a role in a staurosporine-induced caspase-independent apoptotic pathway by regulating the nuclear translocation of AIFM1 and ENDOG and the DNase activity associated with ENDOG. Phosphorylates STK38L on 'Thr-442' and stimulates its kinase activity. Regulates cellular migration with alteration of PTPN12 activity and PXN phosphorylation: phosphorylates PTPN12 and inhibits its activity and may regulate PXN phosphorylation through PTPN12 (By similarity). Acts as a key regulator of axon regeneration in the adult optic nerve and radial nerve.probableB0LT89

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable
2.7.11.1Transferred entry: 2.7.11.19.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3COM, chain A
Confidence level:very confident
Coverage over the Query: 14-280
View the alignment between query and template
View the model in PyMOL
Template: 4APC, chain A
Confidence level:very confident
Coverage over the Query: 14-293
View the alignment between query and template
View the model in PyMOL