Citrus Sinensis ID: 014627

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-

MMSMTSHNLDFGRSVLDLVACGCSSSASIHRSSVRKIAMTGSRKSNRDCGARRLVCCRQNLARCRVYSTKTPETLLNEVGQIPPAVLNLKEKSRSPISLANIFEVVAEDLQTLNQNLKSIVGAENPVLMSAAEQIFGAGGKRLRPALVFLVSRATAELVGLKELTTKHRRLAEIIEMIHTASLIHDDVLDESDMRRGQETVHQLYGTRVAVLAGDFMFAQSSWYLANLENLEVIKLISQVIKDFASGEIKQASSLFDCDLELEEYLIKSYYKTASLIAASTKGAAIFSGVDGSLSKQMYEYGRNLGLSFQIVDDILDFTQSAEQLGKPAASDLAKGNLTAPVIFALEKEPKLREIIESEFCETGSLDEAIKLVKTSGGIEEAQELAKEKANLAIHNLHCLPRSPFRVALEDMVMFNLERFV

ccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHccccccHHHHcccccHHHHHHHHcccHHHHHHHHHccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccc

*********DFGRSVLDLVACGCS************************CGARRLVCCRQNLARCRVYSTKTPETLLNEVGQIPPAVLNLKEKSRSPISLANIFEVVAEDLQTLNQNLKSIVGAENPVLMSAAEQIFGAGGKRLRPALVFLVSRATAELVGLKELTTKHRRLAEIIEMIHTASLIHDDVLDESDMRRGQETVHQLYGTRVAVLAGDFMFAQSSWYLANLENLEVIKLISQVIKDFASGEIKQASSLFDCDLELEEYLIKSYYKTASLIAASTKGAAIFSGVDGSLSKQMYEYGRNLGLSFQIVDDILDFTQSAEQLGKPAASDLAKGNLTAPVIFALEKEPKLREIIESEFCETGSLDEAIKLVKTSGGIEEAQELAKEKANLAIHNLHCLPRSPFRVALEDMVMFNLERFV

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Solanesyl diphosphate synthase 2, chloroplastic	Involved in providing solanesyl diphosphate for plastoquinone-9 formation. Prefers geranylgeranyl diphosphate to farnesyl diphosphate as substrate. No activity with geranyl diphosphate or dimethylallyl diphosphate as substrate.	confident	Q76FS5
Solanesyl-diphosphate synthase 2, chloroplastic	Involved in providing solanesyl diphosphate for plastoquinone-9 formation. Geranyl diphosphate is the preferred substrate.	probable	Q75HZ9
Solanesyl diphosphate synthase 1	Involved in the solanesyl diphosphate biosynthesis in the endoplasmic reticulum. This isoprenoid side chain might be then transferred to the mitochondria for the synthesis of ubiquinone-9. Prefers geranylgeranyl diphosphate to farnesyl diphosphate as substrate. No activity with geranyl diphosphate or dimethylallyl diphosphate as substrate.	probable	Q8S948

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3APZ, chain A
Confidence level:very confident
Coverage over the Query: 103-126,139-188,205-421
View the alignment between query and template
View the model in PyMOL