Citrus Sinensis ID: 014639

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-

MALKNIVKEMRDGIGNISRRGSERRCSENGKHNMRRRGRSYIAPEGSSSSSKIIVEQSQWANMPPELLLDIIQRIEASQTSWPARRDVVACASVCKSWRAVTKEIIRTPEQCGLLSFPVSLKQPGPRDAPIQCYIRRERPTGTYRLYLGLSPDPGDMSKLLLAARKIRKATSTDFLISLVGDDFSRTSNTYVGKLRSNFLGTKFTIYDSQPPCDTAIHSNSRSQRKIFPKQVSLKGSSSNYSVATISYELNVLRTRGPRRMQCTMHSIPISAIQEGGTAPTPIEFTNCCEEQIPSSPSPVSKGKKPLVEFSSTSLSGPLESFGSAGDPLILKNKAPRWHEQLQCWCLNFKGRVTVASVKNFQLVAAAEPNQNVSVAEQERVILQFGKIGKDIFTMDYRYPLSALQAFAICLSSFDTKPACE

ccHHHHHHHHHccccccccccccEEEccccccccccccccCCcccccccccccHHcccccccccHHHHHHHHHHHcccccccccccccEEEccccccHHHHHHHHHccccccccccccccccccccccccEEEEEEECccccccccccccccccccHHHHHHHHHHcccccccEEEEEccccccccccccCEEEEEccccccEEEEEccccccccccccccccccccccccccccccccccccEEEEEEEEccccccccccccccccccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccEEEcccccEEEcccccEEEECccccccccccccccEEEEEEEEccccEEEEEccccccHHHHHHHHHHHcccccccc

*ALKNIV*E*********************************************V**SQWANMPPELLLDIIQRIEASQTSWPARRDVVACASVCKSWRAVTKEIIRTPEQCGLLSFPVSLKQPGPRDAPIQCYIRRERPTGTYRLYLGLSPDPGDMSKLLLAARKIRKATSTDFLISLVGDDFSRTSNTYVGKLRSNFLGTKFTIYDSQPP****************************YSVATISYELNVLRTRGPRRMQCTMHSIPISAIQE******PIEF******************************************PLILKNKAPRWHEQLQCWCLNFKGRVTVASVKNFQLVAAAE*******AEQERVILQFGKIGKDIFTMDYRYPLSALQAFAICLSSFDTKPACE

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Tubby-like F-box protein 6		probable	Q0WPY0
Tubby-like F-box protein 5		probable	Q6Z2G9

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2FIM, chain A
Confidence level:very confident
Coverage over the Query: 121-215,231-292,306-310,321-415
View the alignment between query and template
View the model in PyMOL

Template: 1C8Z, chain A
Confidence level:confident
Coverage over the Query: 123-219,233-320,331-421
View the alignment between query and template
View the model in PyMOL

Template: 1FS1, chain A
Confidence level:confident
Coverage over the Query: 60-103
View the alignment between query and template
View the model in PyMOL