Citrus Sinensis ID: 014649

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-

MDRLSAAARLMIVSDLDHTMVDHHDAENLSLLRFNALWEAHYRRDSLLVFSTGRSPTLYKQLRKEKPMLTPDITIMSVGTEITYGDAMVPDNGWVEVLNQKWDKKIVTEEASRFPELKLQSETEQRPHKVSFYVDKDKAQTVTQKLSEIFKNRGLDVKIIYSGGMDLDILPQGAGKGQALAYLLRKFKCEGKVPTNTLVCGDSGNDAELFSIPEVYGVMVSNAQEELLQWHAANAKNNPKLTHATERCAAGIIQAIGHFKLGPSTSPRDIKDESDGEVKSIDLGHEVVKLYLFYERWRRAEIDNSEIYLSSLKANCCPSGFCVPPSGGEISLAEAINQFRKCYGDKQGKQFRVWVDRVLSTEIGPGTWLVKFHKWELSGEERACSIVSIIVRIKDASDHTYMHVHETWLEGFGANDGRFWI

cccccccccEEEEEEcccccccccccccccHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHcccccccEEEEcccEEEEEcccccccccHHHHHHccccHHHHHHHHccccccEEccccccccEEEEEEEccccHHHHHHHHHHHHHHccccEEEEEEEccEEEEEcccccHHHHHHHHHHHHHccccccccEEEEccccccHHHHHcccEEEEEcccccHHHHHHHHHHccccccEEEcccccHHHHHHHHHHcccccccccccccccccccccccccccEEEEEEHHHHHHHHHcccccHHHHHHHHcccccccEEEccccccccHHHHHHHHHHHHccccccEEEEEEEEEEEEEEcccEEEEEEccEEEEcccccEEEEEEEEEEccccccEEEEEHHHHccccccccccccc

cccccccccEEEEEEccccccccccHHHHHHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHHcccccccEEEEEccEEEEEcccccccHHHHHHHHccccHHHHHHHHHccccccccccHHccccEEEEEEcHHHcHHHHHHHHHHHHHccccEEEEEEcccEEEEccccccHHHHHHHHHHHHcccccccccEEEEcccccHHHHHcccccEEEEEcccHHHHHHHHHHHccccccEEEEccHHHHHHHHHHHHccccccccccccccccHcccccccccHHEEEEEEEEEHcccccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHHHcccccccEEEEEEEEEEEEEccccEEEEEEcccEcccccEEEEEEEEEEEccccccccHHHHEHHHHcccccccccccc

MDRLSAAARLMIVSDldhtmvdhhdaenlSLLRFNALWEAHYRRDsllvfstgrsptLYKQLRkekpmltpditimsvgteitygdamvpdngwVEVLNQKWDKKIVTeeasrfpelklqseteqrphkvsfyvdkdkAQTVTQKLSEIFKnrgldvkiiysggmdldilpqgagKGQALAYLLRKFkcegkvptntlvcgdsgndaelfsipeVYGVMVSNAQEELLQWHAAnaknnpklthATERCAAGIIQAIghfklgpstsprdikdesdgevksidLGHEVVKLYLFYERWrraeidnsEIYLSSlkanccpsgfcvppsggeiSLAEAINQFRKcygdkqgkqfRVWVDRVlsteigpgtwlvKFHKWELSGEERACSIVSIIVRIkdasdhtyMHVHETWlegfgandgrfwi

MDRLSAAARLMIVSDLDHTMVDHHDAENLSLLRFNALWEAHYRRdsllvfstgrsptlykqlrkekpmltpdITIMSVGTEITYGDAMVPDNGWVEVLNQKWDKKIVTEEasrfpelklqseteqrphkvsfyvdkdkaqTVTQKLSEIFKNRGLDVKIIYSGGMDLDILPQGAGKGQALAYLLRKFKCEGKVPTNTLVCGDSGNDAELFSIPEVYGVMVSNAQEELLQWHAANAKNNPKLTHATERCAAGIIQAIGHFKLGPSTSprdikdesdgevksidlgheVVKLYLFYERWRRAEIDNSEIYLSSLKANCCPSGFCVPPSGGEISLAEAINQFRKCYGDKQGKQFRVWVDRVLsteigpgtwlVKFHKWELSGEERACSIVSIIVRIKDASDHTYMHVHEtwlegfganDGRFWI

********RLMIVSDLDHTMVDHHDAENLSLLRFNALWEAHYRRDSLLVFSTGRSPTLYKQLRKEKPMLTPDITIMSVGTEITYGDAMVPDNGWVEVLNQKWDKKIVT**********************SFYVDKDKAQTVTQKLSEIFKNRGLDVKIIYSGGMDLDILPQGAGKGQALAYLLRKFKCEGKVPTNTLVCGDSGNDAELFSIPEVYGVMVSNAQEELLQWHAANAKNNPKLTHATERCAAGIIQAIGHFKL******************SIDLGHEVVKLYLFYERWRRAEIDNSEIYLSSLKANCCPSGFCVPPSGGEISLAEAINQFRKCYGDKQGKQFRVWVDRVLSTEIGPGTWLVKFHKWELSGEERACSIVSIIVRIKDASDHTYMHVHETWLEGFGANDGRFW*

*****AA***MIVSDLDHTMVDHHDAENLSLLRFNALWEAHYRRDSLLVFSTGRSPTLYKQLRKEKPMLTPDITIMSVGTEITYGDAMVPDNGWVEVLNQKWDKKIVTEEASRFPELKLQSETEQRPHKVSFYVDKDKAQTVTQKLSEIFKNRGLDVKIIYSGGMDLDILPQGAGKGQALAYLLRKFKCEGKVPTNTLVCGDSGNDAELFSIPEVYGVMVSNAQEELLQWHAANAKNNPKLTHATERCAAGIIQAIGHFKLGPST******************GHEVVKLYLFYERWRRAEIDNSEIYLSSLKANCCPSGFCVPPSGGEISLAEAINQFRKCYGDKQGKQFRVWVDRVLSTEIGPGTWLVKFHKWELSGEERACSIVSIIVRIKDASDHTYMHVHETWL**FG*****FWI

*****AAARLMIVSDLDHTMVDHHDAENLSLLRFNALWEAHYRRDSLLVFSTGRSPTLYKQLRKEKPMLTPDITIMSVGTEITYGDAMVPDNGWVEVLNQKWDKKIVTEEASRFPELKLQSETEQRPHKVSFYVDKDKAQTVTQKLSEIFKNRGLDVKIIYSGGMDLDILPQGAGKGQALAYLLRKFKCEGKVPTNTLVCGDSGNDAELFSIPEVYGVMVSNAQEELLQWHAANAKNNPKLTHATERCAAGIIQAIGHFKLGPSTSPRDIKDESDGEVKSIDLGHEVVKLYLFYERWRRAEIDNSEIYLSSLKANCCPSGFCVPPSGGEISLAEAINQFRKCYGDKQGKQFRVWVDRVLSTEIGPGTWLVKFHKWELSGEERACSIVSIIVRIKDASDHTYMHVHETWLEGF*********

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		421	2.2.26 [Sep-21-2011]
Q5IH13		425	Sucrose-phosphatase 2 OS=	N/A	no	1.0	0.990	0.726	0.0
Q5IH14		425	Sucrose-phosphatase 1 OS=	N/A	no	1.0	0.990	0.714	0.0
Q9SJ66		422	Probable sucrose-phosphat	yes	no	1.0	0.997	0.695	1e-176
Q94E75		423	Probable sucrose-phosphat	yes	no	0.980	0.976	0.638	1e-156
Q6YXW6		423	Sucrose-phosphatase 2 OS=	no	no	0.980	0.976	0.635	1e-155
Q9C8J4		423	Probable sucrose-phosphat	no	no	1.0	0.995	0.616	1e-152
Q9FQ11		423	Sucrose-phosphatase 1 OS=	N/A	no	0.980	0.976	0.629	1e-151
Q93XN8		423	Probable sucrose-phosphat	no	no	0.997	0.992	0.586	1e-144
A3AZW5		409	Probable sucrose-phosphat	no	no	0.952	0.980	0.550	1e-135
Q84ZX8		437	Sucrose-phosphatase 2 OS=	N/A	no	0.985	0.949	0.520	1e-127

>sp\|Q5IH13\|SPP2_TOBAC Sucrose-phosphatase 2 OS=Nicotiana tabacum GN=SPP2 PE=2 SV=1	Back alignment and function desciption

 Score =  644 bits (1662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/424 (72%), Positives = 356/424 (83%), Gaps = 3/424 (0%)

Query: 1   MDRLSAAARLMIVSDLDHTMVDHHDAENLSLLRFNALWEAHYRRDSLLVFSTGRSPTLYK 60
           MD+L++AARLMIVSDLDHTMVDHHDAENLSLLRFNALWEA+YR +SLLVFSTGRSPTLYK
Sbjct: 1   MDQLTSAARLMIVSDLDHTMVDHHDAENLSLLRFNALWEANYRDNSLLVFSTGRSPTLYK 60

Query: 61  QLRKEKPMLTPDITIMSVGTEITYGDAMVPDNGWVEVLNQKWDKKIVTEEASRFPELKLQ 120
           +LRKEKPMLTPDITIMSVGTEITYG+++VPD+GW   LN KWD+KIVTEE S+FPEL LQ
Sbjct: 61  ELRKEKPMLTPDITIMSVGTEITYGNSVVPDDGWEAFLNNKWDRKIVTEETSKFPELTLQ 120

Query: 121 SETEQRPHKVSFYVDKDKAQTVTQKLSEIFKNRGLDVKIIYSGGMDLDILPQGAGKGQAL 180
           SETEQRPHKVSFYV KDKAQ + + LS+ F+ RGLDVKIIYSGGMDLDILPQGAGKGQAL
Sbjct: 121 SETEQRPHKVSFYVQKDKAQDIMKTLSKRFEERGLDVKIIYSGGMDLDILPQGAGKGQAL 180

Query: 181 AYLLRKFKCEGKVPTNTLVCGDSGNDAELFSIPEVYGVMVSNAQEELLQWHAANAKNNPK 240
           AYLL+K K EGK+P NTL CGDSGNDAELFSIP+VYGVMV+NAQEELLQWHAANAKNNPK
Sbjct: 181 AYLLKKLKSEGKLPNNTLACGDSGNDAELFSIPDVYGVMVANAQEELLQWHAANAKNNPK 240

Query: 241 LTHATERCAAGIIQAIGHFKLGPSTSPRDIKDESDGEVKSIDLGHEVVKLYLFYERWRRA 300
           + HATERCAAGIIQAIGH  LGPSTSPRD+ D SD ++++    +EVVK YLF+E+WRR 
Sbjct: 241 VIHATERCAAGIIQAIGHSNLGPSTSPRDVMDLSDCKMENFVPAYEVVKFYLFFEKWRRG 300

Query: 301 EIDNSEIYLSSLKANCCPSGFCVPPSGGEISLAEAINQFRKCYGDKQGKQFRVWVDRVLS 360
           EI++SE YLS+LKA C PSG  V PSG E SL E +  F  C+GDKQGKQFR+WVD+VL 
Sbjct: 301 EIEHSEHYLSNLKAVCRPSGTFVHPSGVEKSLQECVTLFGTCHGDKQGKQFRIWVDQVLP 360

Query: 361 TEIGPGTWLVKFHKWELSGEERACSIVSIIVRIKD---ASDHTYMHVHETWLEGFGANDG 417
            ++G  +WLV F KWELSGE+R C I ++++  K+   A   T+ HVH+TWL G  A+D 
Sbjct: 361 VQVGSDSWLVSFKKWELSGEDRRCCITTVLLSSKNKTVADGLTWTHVHQTWLNGAAASDS 420

Query: 418 RFWI 421
             W 
Sbjct: 421 ASWF 424

Catalyzes the final step of sucrose synthesis.
Nicotiana tabacum (taxid: 4097)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 2EC: 4

>sp\|Q5IH14\|SPP1_TOBAC Sucrose-phosphatase 1 OS=Nicotiana tabacum GN=SPP1 PE=2 SV=1	Back alignment and function description

>sp\|Q9SJ66\|SPP2_ARATH Probable sucrose-phosphatase 2 OS=Arabidopsis thaliana GN=SPP2 PE=1 SV=2	Back alignment and function description

>sp\|Q94E75\|SPP1_ORYSJ Probable sucrose-phosphatase 1 OS=Oryza sativa subsp. japonica GN=SPP1 PE=2 SV=1	Back alignment and function description

>sp\|Q6YXW6\|SPP2_ORYSJ Sucrose-phosphatase 2 OS=Oryza sativa subsp. japonica GN=SPP2 PE=1 SV=1	Back alignment and function description

>sp\|Q9C8J4\|SPP1_ARATH Probable sucrose-phosphatase 1 OS=Arabidopsis thaliana GN=SPP1 PE=2 SV=1	Back alignment and function description

>sp\|Q9FQ11\|SPP1_MAIZE Sucrose-phosphatase 1 OS=Zea mays GN=SPP1 PE=1 SV=1	Back alignment and function description

>sp\|Q93XN8\|SPP3B_ARATH Probable sucrose-phosphatase 3b OS=Arabidopsis thaliana GN=SPP3B PE=2 SV=1	Back alignment and function description

>sp\|A3AZW5\|SPP3_ORYSJ Probable sucrose-phosphatase 3 OS=Oryza sativa subsp. japonica GN=SPP3 PE=3 SV=1	Back alignment and function description

>sp\|Q84ZX8\|SPP2_MAIZE Sucrose-phosphatase 2 OS=Zea mays GN=SPP2 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		421
224091475		424	predicted protein [Populus trichocarpa]	1.0	0.992	0.751	0.0
224138242		425	predicted protein [Populus trichocarpa]	1.0	0.990	0.756	0.0
46093878		425	sucrose phosphate phosphatase [Malus x d	1.0	0.990	0.752	0.0
225439336		424	PREDICTED: sucrose-phosphatase 1 [Vitis	0.997	0.990	0.742	0.0
255566221		421	sucrose phosphate phosphatase, putative	0.997	0.997	0.743	0.0
112383510		425	sucrose phosphatase [Coffea canephora]	1.0	0.990	0.726	0.0
69205181		421	sucrose phosphate phosphatase [Ricinus c	0.997	0.997	0.738	0.0
75105380		425	RecName: Full=Sucrose-phosphatase 2; Sho	1.0	0.990	0.726	0.0
46093882		425	sucrose phosphate phosphatase [Actinidia	1.0	0.990	0.721	0.0
153861779		425	sucrose-phosphatase [Solanum tuberosum]	1.0	0.990	0.719	0.0

>gi\|224091475\|ref\|XP_002309266.1\| predicted protein [Populus trichocarpa] gi\|222855242\|gb\|EEE92789.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  669 bits (1725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/423 (75%), Positives = 360/423 (85%), Gaps = 2/423 (0%)

Query: 1   MDRLSAAARLMIVSDLDHTMVDHHDAENLSLLRFNALWEAHYRRDSLLVFSTGRSPTLYK 60
           MDRL A ARLMIVSDLDHTMVDHHD EN+SLLRFNALWEA YR DSLLVFSTGRSPTLYK
Sbjct: 1   MDRLKAPARLMIVSDLDHTMVDHHDPENMSLLRFNALWEACYRNDSLLVFSTGRSPTLYK 60

Query: 61  QLRKEKPMLTPDITIMSVGTEITYGDAMVPDNGWVEVLNQKWDKKIVTEEASRFPELKLQ 120
           QLRKEKPMLTPDITIMSVGTEITYG +MVPD+GWVEVLNQKWD+ +VTEE S+FPEL LQ
Sbjct: 61  QLRKEKPMLTPDITIMSVGTEITYGTSMVPDDGWVEVLNQKWDRNLVTEETSKFPELTLQ 120

Query: 121 SETEQRPHKVSFYVDKDKAQTVTQKLSEIFKNRGLDVKIIYSGGMDLDILPQGAGKGQAL 180
           SETEQRPHKVSFYVDK  AQ VT+ LSEIF  RGLDVKIIYSGGMDLDILPQGAGKGQAL
Sbjct: 121 SETEQRPHKVSFYVDKANAQNVTKALSEIFAKRGLDVKIIYSGGMDLDILPQGAGKGQAL 180

Query: 181 AYLLRKFKCEGKVPTNTLVCGDSGNDAELFSIPEVYGVMVSNAQEELLQWHAANAKNNPK 240
           AYL +KFK EGK+P NTLVCGDSGNDAELFSIP+V+GVMVSNAQEELLQWHA NAK N K
Sbjct: 181 AYLHKKFKTEGKLPANTLVCGDSGNDAELFSIPDVHGVMVSNAQEELLQWHAENAKGNAK 240

Query: 241 LTHATERCAAGIIQAIGHFKLGPSTSPRDIKDESDGEVKSIDLGHEVVKLYLFYERWRRA 300
           + HATERCAAGIIQAIGHFKLGP+TSPRD  + S  E ++I    E+V+ ++FYERWRRA
Sbjct: 241 IIHATERCAAGIIQAIGHFKLGPNTSPRDTTNLSYFESENISASSEIVRFFMFYERWRRA 300

Query: 301 EIDNSEIYLSSLKANCCPSGFCVPPSGGEISLAEAINQFRKCYGDKQGKQFRVWVDRVLS 360
           E++NSE+YL+S+KA+C  SG  + PSG E+SL +A+N+ R  YGDKQG++FRVWVDRVLS
Sbjct: 301 EVENSELYLASMKADCDSSGILIHPSGAELSLCDALNEMRSYYGDKQGQKFRVWVDRVLS 360

Query: 361 TEIGPGTWLVKFHKWELSGEERACSIVSIIVRIKD--ASDHTYMHVHETWLEGFGANDGR 418
            + G  TWLVKF+KWELSG+E+   +++ I+ IK    S  TYMHVHETWLEG GA D  
Sbjct: 361 IQTGLDTWLVKFNKWELSGDEQQGCVITCIINIKKDGVSGATYMHVHETWLEGSGAKDQS 420

Query: 419 FWI 421
            W+
Sbjct: 421 TWL 423

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224138242\|ref\|XP_002322765.1\| predicted protein [Populus trichocarpa] gi\|222867395\|gb\|EEF04526.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|46093878\|gb\|AAS79792.1\| sucrose phosphate phosphatase [Malus x domestica]	Back alignment and taxonomy information

>gi\|225439336\|ref\|XP_002269810.1\| PREDICTED: sucrose-phosphatase 1 [Vitis vinifera] gi\|147839687\|emb\|CAN77297.1\| hypothetical protein VITISV_022385 [Vitis vinifera] gi\|296089337\|emb\|CBI39109.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255566221\|ref\|XP_002524098.1\| sucrose phosphate phosphatase, putative [Ricinus communis] gi\|223536666\|gb\|EEF38308.1\| sucrose phosphate phosphatase, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|112383510\|gb\|ABI17892.1\| sucrose phosphatase [Coffea canephora]	Back alignment and taxonomy information

>gi\|69205181\|gb\|AAZ03742.1\| sucrose phosphate phosphatase [Ricinus communis]	Back alignment and taxonomy information

>gi\|75105380\|sp\|Q5IH13.1\|SPP2_TOBAC RecName: Full=Sucrose-phosphatase 2; Short=NtSPP2 gi\|57018995\|gb\|AAW32903.1\| sucrose-6-phosphate phosphatase [Nicotiana tabacum]	Back alignment and taxonomy information

>gi\|46093882\|gb\|AAS79794.1\| sucrose phosphate phosphatase [Actinidia chinensis]	Back alignment and taxonomy information

>gi\|153861779\|gb\|ABS52706.1\| sucrose-phosphatase [Solanum tuberosum]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		421
TAIR\|locus:2039295		422	AT2G35840 [Arabidopsis thalian	1.0	0.997	0.695	1.4e-160
TAIR\|locus:2033893		423	SPP1 "sucrose-phosphatase 1" [	1.0	0.995	0.616	7.5e-144
TAIR\|locus:2100544		423	SPP2 "sucrose-6F-phosphate pho	0.997	0.992	0.586	1.6e-132
TAIR\|locus:2080295		425	AT3G54270 [Arabidopsis thalian	0.997	0.988	0.522	6.2e-117
UNIPROTKB\|A9CK30		248	mfppA "Mannosylfructose-phosph	0.565	0.959	0.311	1.1e-22
TIGR_CMR\|BA_4271		268	BA_4271 "hydrolase, haloacid d	0.306	0.481	0.270	7.3e-06

TAIR\|locus:2039295 AT2G35840 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1564 (555.6 bits), Expect = 1.4e-160, P = 1.4e-160
 Identities = 293/421 (69%), Positives = 343/421 (81%)

Query:     1 MDRLSAAARLMIVSDLDHTMVDHHDAENLSLLRFNALWEAHYRRDSLLVFSTGRSPTLYK 60
             M+RL++  RLMIVSDLDHTMVDHHD ENLSLLRFN+LWE  YR DSLLVFSTGRSPTLYK
Sbjct:     1 MERLTSPPRLMIVSDLDHTMVDHHDPENLSLLRFNSLWEHAYRHDSLLVFSTGRSPTLYK 60

Query:    61 QLRKEKPMLTPDITIMSVGTEITYGDAMVPDNGWVEVLNQKWDKKIVTEEASRFPELKLQ 120
             +LRKEKP+LTPDITIMSVGTEITYG++MVPD+GWVE LN KWD  IV +EAS FPELKLQ
Sbjct:    61 ELRKEKPLLTPDITIMSVGTEITYGNSMVPDHGWVEALNNKWDLGIVKQEASNFPELKLQ 120

Query:   121 SETEQRPHKVSFYVDKDKAQTVTQKLSEIFKNRGLDVKIIYSGGMDLDILPQGAGKGQAL 180
             +ETEQRPHKVSFYV+K KAQ VT++LS+ F  RGLDVKIIYSGGMDLDILPQGAGKGQAL
Sbjct:   121 AETEQRPHKVSFYVEKSKAQEVTKELSQRFLKRGLDVKIIYSGGMDLDILPQGAGKGQAL 180

Query:   181 AYLLRKFKCEGKVPTNTLVCGDSGNDAELFSIPEVYGVMVSNAQEELLQWHAANAKNNPK 240
             AYLL+K K EGK+P NTL CGDSGNDAELFSIP+VYGVMVSNAQEELL+WHA NAK+NPK
Sbjct:   181 AYLLKKLKTEGKLPVNTLACGDSGNDAELFSIPDVYGVMVSNAQEELLKWHAENAKDNPK 240

Query:   241 LTHATERCAAGIIQAIGHFKLGPSTSPRDIKDESDGEVKSIDLGHEVVKLYLFYERWRRA 300
             + HA ERCA GIIQAIGHFKLGP+ SPRD+ D  + +V++++ GHEVVK +LFYERWRR 
Sbjct:   241 VIHAKERCAGGIIQAIGHFKLGPNLSPRDVSDFLEIKVENVNPGHEVVKFFLFYERWRRG 300

Query:   301 EIDNSEIYLSSLKANCCPSGFCVPPSGGEISLAEAINQFRKCYGDKQGKQFRVWVDRVLS 360
             E++NSE Y +SLKA+  P G  V PSG E SL + I++ RK +GDKQGK+FRVW D+VL+
Sbjct:   301 EVENSEAYTASLKASVHPGGVFVHPSGTEKSLRDTIDELRKYHGDKQGKKFRVWADQVLA 360

Query:   361 TEIGPGTWLVKFHKWELSGEERACSIVSIIVRIKDASDHTYMHVHETWLEGFGANDGRFW 420
             T+  PGTW+VK  KWE  G+ER C   ++    K+     + HV +TW +     D   W
Sbjct:   361 TDTTPGTWIVKLDKWEQDGDERRCCTTTVKFTSKEGEGLVWEHVQQTWSKETMVKDDSSW 420

Query:   421 I 421
             I
Sbjct:   421 I 421

GO:0000287 "magnesium ion binding" evidence=IEA

GO:0003824 "catalytic activity" evidence=IEA

GO:0005986 "sucrose biosynthetic process" evidence=IEA;ISS

GO:0008152 "metabolic process" evidence=IEA

GO:0016791 "phosphatase activity" evidence=IEA

GO:0050307 "sucrose-phosphate phosphatase activity" evidence=IEA;ISS

GO:0005634 "nucleus" evidence=IDA

GO:0005737 "cytoplasm" evidence=IDA

GO:0046686 "response to cadmium ion" evidence=IEP

GO:0005829 "cytosol" evidence=IDA

GO:0009506 "plasmodesma" evidence=IDA

TAIR\|locus:2033893 SPP1 "sucrose-phosphatase 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2100544 SPP2 "sucrose-6F-phosphate phosphohydrolase 2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2080295 AT3G54270 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|A9CK30 mfppA "Mannosylfructose-phosphate phosphatase" [Agrobacterium fabrum str. C58 (taxid:176299)]	Back alignment and assigned GO terms

TIGR_CMR\|BA_4271 BA_4271 "hydrolase, haloacid dehalogenase-like family" [Bacillus anthracis str. Ames (taxid:198094)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q5IH13	SPP2_TOBAC	3, ., 1, ., 3, ., 2, 4	0.7264	1.0	0.9905	N/A	no
Q94E75	SPP1_ORYSJ	3, ., 1, ., 3, ., 2, 4	0.6380	0.9809	0.9763	yes	no
Q9SJ66	SPP2_ARATH	3, ., 1, ., 3, ., 2, 4	0.6959	1.0	0.9976	yes	no
Q9FQ11	SPP1_MAIZE	3, ., 1, ., 3, ., 2, 4	0.6298	0.9809	0.9763	N/A	no
Q84ZX8	SPP2_MAIZE	3, ., 1, ., 3, ., 2, 4	0.5207	0.9857	0.9496	N/A	no
Q5IH14	SPP1_TOBAC	3, ., 1, ., 3, ., 2, 4	0.7146	1.0	0.9905	N/A	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	3.1.3	0.983
3rd Layer	3.1.3.79	LOW CONFIDENCE prediction!
3rd Layer	3.1.3.24	0.979

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		421
PLN02382		413	PLN02382, PLN02382, probable sucrose-phosphatase	0.0
TIGR01485		249	TIGR01485, SPP_plant-cyano, sucrose-6F-phosphate p	1e-137
pfam05116		247	pfam05116, S6PP, Sucrose-6F-phosphate phosphohydro	1e-137
TIGR01482		225	TIGR01482, SPP-subfamily, sucrose-phosphate phosph	8e-69
pfam08472		133	pfam08472, S6PP_C, Sucrose-6-phosphate phosphohydr	4e-68
TIGR02471		236	TIGR02471, sucr_syn_bact_C, sucrose phosphate synt	4e-38
TIGR01484		204	TIGR01484, HAD-SF-IIB, HAD-superfamily hydrolase,	4e-36
COG0561		264	COG0561, Cof, Predicted hydrolases of the HAD supe	6e-15
pfam08282		254	pfam08282, Hydrolase_3, haloacid dehalogenase-like	4e-14
TIGR00099		256	TIGR00099, Cof-subfamily, Cof subfamily of IIB sub	1e-10
PRK01158		230	PRK01158, PRK01158, phosphoglycolate phosphatase;	1e-07
TIGR01487		215	TIGR01487, Pglycolate_arch, phosphoglycolate phosp	1e-06
TIGR01486		256	TIGR01486, HAD-SF-IIB-MPGP, mannosyl-3-phosphoglyc	7e-04

>gnl\|CDD\|178008 PLN02382, PLN02382, probable sucrose-phosphatase	Back alignment and domain information

 Score =  786 bits (2032), Expect = 0.0
 Identities = 300/413 (72%), Positives = 351/413 (84%), Gaps = 2/413 (0%)

Query: 1   MDRLSAAARLMIVSDLDHTMVDHHDAENLSLLRFNALWEAHYRRDSLLVFSTGRSPTLYK 60
           MDRLS + RLMIVSDLDHTMVDHHD ENLSLLRFNALWEA YR DSLLVFSTGRSPTLYK
Sbjct: 1   MDRLSGSPRLMIVSDLDHTMVDHHDPENLSLLRFNALWEAEYRHDSLLVFSTGRSPTLYK 60

Query: 61  QLRKEKPMLTPDITIMSVGTEITYGDAMVPDNGWVEVLNQKWDKKIVTEEASRFPELKLQ 120
           +LRKEKP+LTPDITIMSVGTEI YG++MVPD+GWVE LN+KWD++IV EE S+FPELKLQ
Sbjct: 61  ELRKEKPLLTPDITIMSVGTEIAYGESMVPDHGWVEYLNKKWDREIVVEETSKFPELKLQ 120

Query: 121 SETEQRPHKVSFYVDKDKAQTVTQKLSEIFKNRGLDVKIIYSGGMDLDILPQGAGKGQAL 180
            ETEQRPHKVSFYVDK KAQ V ++LSE  + RGLDVKIIYSGG+DLD+LPQGAGKGQAL
Sbjct: 121 PETEQRPHKVSFYVDKKKAQEVIKELSERLEKRGLDVKIIYSGGIDLDVLPQGAGKGQAL 180

Query: 181 AYLLRKFKCEGKVPTNTLVCGDSGNDAELFSIPEVYGVMVSNAQEELLQWHAANAKNNPK 240
           AYLL+K K EGK P NTLVCGDSGNDAELFS+P+VYGVMVSNAQEELLQW+A NAK+NPK
Sbjct: 181 AYLLKKLKAEGKAPVNTLVCGDSGNDAELFSVPDVYGVMVSNAQEELLQWYAENAKDNPK 240

Query: 241 LTHATERCAAGIIQAIGHFKLGPSTSPRDIKDESDGEVKSIDLGHEVVKLYLFYERWRRA 300
           + HATERCAAGIIQAIGHF LGP+ SPRD+ D   G++ +++  HEVVK YLFYE+WRR 
Sbjct: 241 IIHATERCAAGIIQAIGHFNLGPNVSPRDVSDFLYGKLDNVNPAHEVVKFYLFYEKWRRG 300

Query: 301 EIDNSEIYLSSLKANCCPSGFCVPPSGGEISLAEAINQFRKCYGDKQGKQFRVWVDRVLS 360
           E++NS+     LK++C P+G  V PSG E SL ++I++ R CYGDK+GK+FRVWVDRVLS
Sbjct: 301 EVENSDEVFQRLKSSCAPNGVFVHPSGVEKSLHDSIDELRSCYGDKKGKKFRVWVDRVLS 360

Query: 361 TEIGPGTWLVKFHKWELSGEERACSIVSIIVRIK-DASDH-TYMHVHETWLEG 411
           T++GP TWLVKF KWE SG+ER C + + ++  K D  +   +MHVH+TWLEG
Sbjct: 361 TQLGPDTWLVKFDKWEQSGDERKCCLTTALLTSKEDTPNGLEWMHVHQTWLEG 413

Length = 413

>gnl\|CDD\|130549 TIGR01485, SPP_plant-cyano, sucrose-6F-phosphate phosphohydrolase	Back alignment and domain information

>gnl\|CDD\|218442 pfam05116, S6PP, Sucrose-6F-phosphate phosphohydrolase	Back alignment and domain information

>gnl\|CDD\|233433 TIGR01482, SPP-subfamily, sucrose-phosphate phosphatase subfamily	Back alignment and domain information

>gnl\|CDD\|192045 pfam08472, S6PP_C, Sucrose-6-phosphate phosphohydrolase C-terminal	Back alignment and domain information

>gnl\|CDD\|131524 TIGR02471, sucr_syn_bact_C, sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial	Back alignment and domain information

>gnl\|CDD\|233434 TIGR01484, HAD-SF-IIB, HAD-superfamily hydrolase, subfamily IIB	Back alignment and domain information

>gnl\|CDD\|223635 COG0561, Cof, Predicted hydrolases of the HAD superfamily [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|219777 pfam08282, Hydrolase_3, haloacid dehalogenase-like hydrolase	Back alignment and domain information

>gnl\|CDD\|232824 TIGR00099, Cof-subfamily, Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily	Back alignment and domain information

>gnl\|CDD\|234910 PRK01158, PRK01158, phosphoglycolate phosphatase; Provisional	Back alignment and domain information

>gnl\|CDD\|213628 TIGR01487, Pglycolate_arch, phosphoglycolate phosphatase, TA0175-type	Back alignment and domain information

>gnl\|CDD\|130550 TIGR01486, HAD-SF-IIB-MPGP, mannosyl-3-phosphoglycerate phosphatase family	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		421
PLN02382		413	probable sucrose-phosphatase	100.0
PF08472		133	S6PP_C: Sucrose-6-phosphate phosphohydrolase C-ter	100.0
PF05116		247	S6PP: Sucrose-6F-phosphate phosphohydrolase; Inter	100.0
TIGR01485		249	SPP_plant-cyano sucrose-6F-phosphate phosphohydrol	100.0
PRK10513		270	sugar phosphate phosphatase; Provisional	100.0
PRK15126		272	thiamin pyrimidine pyrophosphate hydrolase; Provis	100.0
PRK10976		266	putative hydrolase; Provisional	100.0
TIGR02471		236	sucr_syn_bact_C sucrose phosphate synthase, sucros	100.0
COG0561		264	Cof Predicted hydrolases of the HAD superfamily [G	100.0
PRK01158		230	phosphoglycolate phosphatase; Provisional	100.0
TIGR01482		225	SPP-subfamily Sucrose-phosphate phosphatase subfam	100.0
PLN02887		580	hydrolase family protein	100.0
PF08282		254	Hydrolase_3: haloacid dehalogenase-like hydrolase;	100.0
PRK10530		272	pyridoxal phosphate (PLP) phosphatase; Provisional	100.0
COG4460		130	Uncharacterized protein conserved in bacteria [Fun	100.0
PRK03669		271	mannosyl-3-phosphoglycerate phosphatase; Reviewed	99.98
TIGR01487		215	SPP-like sucrose-phosphate phosphatase-like hydrol	99.97
TIGR00099		256	Cof-subfamily Cof subfamily of IIB subfamily of ha	99.97
TIGR01486		256	HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph	99.97
PRK00192		273	mannosyl-3-phosphoglycerate phosphatase; Reviewed	99.96
PTZ00174		247	phosphomannomutase; Provisional	99.95
PRK14502		694	bifunctional mannosyl-3-phosphoglycerate synthase/	99.93
TIGR01484		204	HAD-SF-IIB HAD-superfamily hydrolase, subfamily II	99.93
TIGR02463		221	MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r	99.92
PRK10187		266	trehalose-6-phosphate phosphatase; Provisional	99.92
PRK12702		302	mannosyl-3-phosphoglycerate phosphatase; Reviewed	99.91
TIGR02468		1050	sucrsPsyn_pln sucrose phosphate synthase/possible	99.89
TIGR02461		225	osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat	99.88
PLN02423		245	phosphomannomutase	99.88
PRK14501		726	putative bifunctional trehalose-6-phosphate syntha	99.86
TIGR00685		244	T6PP trehalose-phosphatase. At least 18 distinct s	99.85
PLN02580		384	trehalose-phosphatase	99.81
PLN02205		854	alpha,alpha-trehalose-phosphate synthase [UDP-form	99.8
COG3769		274	Predicted hydrolase (HAD superfamily) [General fun	99.77
PLN03017		366	trehalose-phosphatase	99.77
PLN02151		354	trehalose-phosphatase	99.7
TIGR02726		169	phenyl_P_delta phenylphosphate carboxylase, delta	99.65
TIGR01670		154	YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho	99.6
PF02358		235	Trehalose_PPase: Trehalose-phosphatase; InterPro:	99.6
COG1877		266	OtsB Trehalose-6-phosphatase [Carbohydrate transpo	99.55
PRK09484		183	3-deoxy-D-manno-octulosonate 8-phosphate phosphata	99.54
PLN03063		797	alpha,alpha-trehalose-phosphate synthase (UDP-form	99.52
PLN03064		934	alpha,alpha-trehalose-phosphate synthase (UDP-form	99.51
PRK11133		322	serB phosphoserine phosphatase; Provisional	99.47
COG1778		170	Low specificity phosphatase (HAD superfamily) [Gen	99.45
KOG3189		252	consensus Phosphomannomutase [Lipid transport and	99.31
COG0560		212	SerB Phosphoserine phosphatase [Amino acid transpo	99.18
cd01427		139	HAD_like Haloacid dehalogenase-like hydrolases. Th	99.11
COG0546		220	Gph Predicted phosphatases [General function predi	99.06
PF03332		220	PMM: Eukaryotic phosphomannomutase; InterPro: IPR0	99.03
TIGR00338		219	serB phosphoserine phosphatase SerB. Phosphoserine	98.99
TIGR01457		249	HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr	98.97
PRK13288		214	pyrophosphatase PpaX; Provisional	98.94
PRK13223		272	phosphoglycolate phosphatase; Provisional	98.91
PRK10826		222	2-deoxyglucose-6-phosphatase; Provisional	98.88
TIGR01491		201	HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa	98.84
PRK13226		229	phosphoglycolate phosphatase; Provisional	98.79
PRK10444		248	UMP phosphatase; Provisional	98.77
KOG1050		732	consensus Trehalose-6-phosphate synthase component	98.77
PRK10725		188	fructose-1-P/6-phosphogluconate phosphatase; Provi	98.76
TIGR01452		279	PGP_euk phosphoglycolate/pyridoxal phosphate phosp	98.75
PRK11590		211	hypothetical protein; Provisional	98.73
PRK13222		226	phosphoglycolate phosphatase; Provisional	98.73
TIGR01458		257	HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr	98.72
TIGR01422		253	phosphonatase phosphonoacetaldehyde hydrolase. Thi	98.71
PLN02770		248	haloacid dehalogenase-like hydrolase family protei	98.7
TIGR02137		203	HSK-PSP phosphoserine phosphatase/homoserine phosp	98.69
PRK13225		273	phosphoglycolate phosphatase; Provisional	98.69
PRK13478		267	phosphonoacetaldehyde hydrolase; Provisional	98.68
TIGR01662		132	HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I	98.66
PLN02575		381	haloacid dehalogenase-like hydrolase	98.66
PLN03243		260	haloacid dehalogenase-like hydrolase; Provisional	98.66
TIGR01449		213	PGP_bact 2-phosphoglycolate phosphatase, prokaryot	98.64
PRK11587		218	putative phosphatase; Provisional	98.63
smart00775		157	LNS2 LNS2 domain. This domain is found in Saccharo	98.62
PLN02779		286	haloacid dehalogenase-like hydrolase family protei	98.59
PRK14988		224	GMP/IMP nucleotidase; Provisional	98.58
TIGR01488		177	HAD-SF-IB Haloacid Dehalogenase superfamily, subfa	98.57
TIGR01454		205	AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes	98.57
TIGR03351		220	PhnX-like phosphonatase-like hydrolase. This clade	98.57
PRK13582		205	thrH phosphoserine phosphatase; Provisional	98.55
TIGR02253		221	CTE7 HAD superfamily (subfamily IA) hydrolase, TIG	98.54
TIGR01656		147	Histidinol-ppas histidinol-phosphate phosphatase f	98.53
TIGR02009		185	PGMB-YQAB-SF beta-phosphoglucomutase family hydrol	98.52
PLN02645		311	phosphoglycolate phosphatase	98.52
PLN02954		224	phosphoserine phosphatase	98.48
TIGR01990		185	bPGM beta-phosphoglucomutase. The enzyme from L. l	98.47
TIGR01684		301	viral_ppase viral phosphatase. These proteins also	98.44
PRK08942		181	D,D-heptose 1,7-bisphosphate phosphatase; Validate	98.42
TIGR01664		166	DNA-3'-Pase DNA 3'-phosphatase. The central phosph	98.41
TIGR01681		128	HAD-SF-IIIC HAD-superfamily phosphatase, subfamily	98.4
PLN02940		382	riboflavin kinase	98.39
TIGR00213		176	GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase	98.39
TIGR02252		203	DREG-2 REG-2-like, HAD superfamily (subfamily IA)	98.36
TIGR01428		198	HAD_type_II 2-haloalkanoic acid dehalogenase, type	98.34
TIGR01261		161	hisB_Nterm histidinol-phosphatase. This model desc	98.33
PHA02597		197	30.2 hypothetical protein; Provisional	98.32
TIGR01689		126	EcbF-BcbF capsule biosynthesis phosphatase. Due to	98.29
PRK10563		221	6-phosphogluconate phosphatase; Provisional	98.26
TIGR01993		184	Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These	98.26
PRK06769		173	hypothetical protein; Validated	98.24
TIGR01459		242	HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas	98.22
TIGR01549		154	HAD-SF-IA-v1 haloacid dehalogenase superfamily, su	98.21
PHA03398		303	viral phosphatase superfamily protein; Provisional	98.2
PRK09552		219	mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp	98.19
PRK06698		459	bifunctional 5'-methylthioadenosine/S-adenosylhomo	98.18
PRK08238		479	hypothetical protein; Validated	98.17
TIGR01548		197	HAD-SF-IA-hyp1 haloacid dehalogenase superfamily,	98.15
PRK09449		224	dUMP phosphatase; Provisional	98.14
COG0637		221	Predicted phosphatase/phosphohexomutase [General f	98.14
TIGR01460		236	HAD-SF-IIA Haloacid Dehalogenase Superfamily Class	98.13
TIGR01668		170	YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph	98.13
PRK05446		354	imidazole glycerol-phosphate dehydratase/histidino	98.11
TIGR01545		210	YfhB_g-proteo haloacid dehalogenase superfamily, s	98.1
PHA02530		300	pseT polynucleotide kinase; Provisional	98.07
PRK11009		237	aphA acid phosphatase/phosphotransferase; Provisio	98.02
PRK10748		238	flavin mononucleotide phosphatase; Provisional	98.02
TIGR02247		211	HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li	98.01
TIGR01525		556	ATPase-IB_hvy heavy metal translocating P-type ATP	97.97
TIGR01685		174	MDP-1 magnesium-dependent phosphatase-1. This mode	97.96
TIGR02254		224	YjjG/YfnB HAD superfamily (subfamily IA) hydrolase	97.95
PRK09456		199	?-D-glucose-1-phosphatase; Provisional	97.95
PLN02919		1057	haloacid dehalogenase-like hydrolase family protei	97.91
TIGR03333		214	salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl	97.91
TIGR01489		188	DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent	97.83
PF13474		121	SnoaL_3: SnoaL-like domain; PDB: 2GXF_A 3KSP_A 3KE	97.76
TIGR01106		997	ATPase-IIC_X-K sodium or proton efflux -- potassiu	97.73
smart00577		148	CPDc catalytic domain of ctd-like phosphatases.	97.72
COG0647		269	NagD Predicted sugar phosphatases of the HAD super	97.72
PRK10671		834	copA copper exporting ATPase; Provisional	97.67
PF14534		107	DUF4440: Domain of unknown function (DUF4440); PDB	97.66
COG0241		181	HisB Histidinol phosphatase and related phosphatas	97.66
TIGR01523		1053	ATPase-IID_K-Na potassium and/or sodium efflux P-t	97.61
COG2179		175	Predicted hydrolase of the HAD superfamily [Genera	97.58
TIGR01672		237	AphA HAD superfamily (subfamily IIIB) phosphatase,	97.58
TIGR01686		320	FkbH FkbH-like domain. The C-terminal portion of t	97.57
TIGR01517		941	ATPase-IIB_Ca plasma-membrane calcium-translocatin	97.56
COG1011		229	Predicted hydrolase (HAD superfamily) [General fun	97.42
TIGR01647		755	ATPase-IIIA_H plasma-membrane proton-efflux P-type	97.41
TIGR01524		867	ATPase-IIIB_Mg magnesium-translocating P-type ATPa	97.41
TIGR01511		562	ATPase-IB1_Cu copper-(or silver)-translocating P-t	97.41
TIGR01497		675	kdpB K+-transporting ATPase, B subunit. One sequen	97.39
TIGR01512		536	ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo	97.34
PRK01122		679	potassium-transporting ATPase subunit B; Provision	97.33
PRK10517		902	magnesium-transporting ATPase MgtA; Provisional	97.33
TIGR01522		884	ATPase-IIA2_Ca golgi membrane calcium-translocatin	97.31
PRK15122		903	magnesium-transporting ATPase; Provisional	97.31
TIGR01116		917	ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium	97.31
TIGR01663		526	PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase	97.29
PF00702		215	Hydrolase: haloacid dehalogenase-like hydrolase; I	97.24
PRK14010		673	potassium-transporting ATPase subunit B; Provision	97.21
TIGR01490		202	HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol	97.19
PF13242		75	Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OY	97.13
KOG3040		262	consensus Predicted sugar phosphatase (HAD superfa	97.1
COG2217		713	ZntA Cation transport ATPase [Inorganic ion transp	97.08
PRK11033		741	zntA zinc/cadmium/mercury/lead-transporting ATPase	97.06
COG0474		917	MgtA Cation transport ATPase [Inorganic ion transp	97.05
TIGR01544		277	HAD-SF-IE haloacid dehalogenase superfamily, subfa	97.02
TIGR01657		1054	P-ATPase-V P-type ATPase of unknown pump specifici	96.98
PTZ00445		219	p36-lilke protein; Provisional	96.91
PF12689		169	Acid_PPase: Acid Phosphatase; InterPro: IPR010036	96.91
PF08235		157	LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209	96.84
PF06437		408	ISN1: IMP-specific 5'-nucleotidase; InterPro: IPR0	96.71
PF13344		101	Hydrolase_6: Haloacid dehalogenase-like hydrolase;	96.68
TIGR01675		229	plant-AP plant acid phosphatase. This model explic	96.59
TIGR01652		1057	ATPase-Plipid phospholipid-translocating P-type AT	96.37
COG4087		152	Soluble P-type ATPase [General function prediction	96.26
TIGR02246		128	conserved hypothetical protein. This family consis	96.22
TIGR01691		220	enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen	95.94
PF08645		159	PNK3P: Polynucleotide kinase 3 phosphatase; InterP	95.84
TIGR01533		266	lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil	95.79
COG4359		220	Uncharacterized conserved protein [Function unknow	95.78
PF13419		176	HAD_2: Haloacid dehalogenase-like hydrolase; PDB:	95.71
PLN03190		1178	aminophospholipid translocase; Provisional	95.7
KOG0207		951	consensus Cation transport ATPase [Inorganic ion t	95.54
TIGR01509		183	HAD-SF-IA-v3 haloacid dehalogenase superfamily, su	95.43
KOG0203		1019	consensus Na+/K+ ATPase, alpha subunit [Inorganic	95.35
KOG0202		972	consensus Ca2+ transporting ATPase [Inorganic ion	95.18
KOG2116		738	consensus Protein involved in plasmid maintenance/	95.17
PLN02811		220	hydrolase	95.11
PF12710		192	HAD: haloacid dehalogenase-like hydrolase; PDB: 3P	95.11
KOG0210		1051	consensus P-type ATPase [Inorganic ion transport a	94.69
TIGR01456		321	CECR5 HAD-superfamily class IIA hydrolase, TIGR014	94.29
PF03767		229	Acid_phosphat_B: HAD superfamily, subfamily IIIB (	94.28
PF05152		297	DUF705: Protein of unknown function (DUF705); Inte	94.09
PF09419		168	PGP_phosphatase: Mitochondrial PGP phosphatase; In	94.09
TIGR01680		275	Veg_Stor_Prot vegetative storage protein. The prot	94.03
KOG2914		222	consensus Predicted haloacid-halidohydrolase and r	93.97
KOG3085		237	consensus Predicted hydrolase (HAD superfamily) [G	93.8
COG3882		574	FkbH Predicted enzyme involved in methoxymalonyl-A	93.24
TIGR01494		499	ATPase_P-type ATPase, P-type (transporting), HAD s	93.09
COG5083		580	SMP2 Uncharacterized protein involved in plasmid m	92.88
PF12680		102	SnoaL_2: SnoaL-like domain; PDB: 3F40_A 3RGA_A 3G8	92.74
PF03031		159	NIF: NLI interacting factor-like phosphatase; Inte	92.45
TIGR02251		162	HIF-SF_euk Dullard-like phosphatase domain. This d	92.37
TIGR02250		156	FCP1_euk FCP1-like phosphatase, phosphatase domain	92.27
COG4319		137	Ketosteroid isomerase homolog [Function unknown]	92.14
COG4996		164	Predicted phosphatase [General function prediction	92.03
PF08332		128	CaMKII_AD: Calcium/calmodulin dependent protein ki	91.61
TIGR01493		175	HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su	91.47
COG3700		237	AphA Acid phosphatase (class B) [General function	91.4
PF06888		234	Put_Phosphatase: Putative Phosphatase; InterPro: I	91.08
KOG0209		1160	consensus P-type ATPase [Inorganic ion transport a	90.96
PF12893		116	Lumazine_bd_2: Putative lumazine-binding; PDB: 3BL	90.9
TIGR02245		195	HAD_IIID1 HAD-superfamily subfamily IIID hydrolase	90.73
KOG1615		227	consensus Phosphoserine phosphatase [Amino acid tr	90.56
TIGR01493		175	HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su	88.4
TIGR01672		237	AphA HAD superfamily (subfamily IIIB) phosphatase,	88.05
COG2216		681	KdpB High-affinity K+ transport system, ATPase cha	85.92
KOG3120		256	consensus Predicted haloacid dehalogenase-like hyd	85.26
COG4030		315	Uncharacterized protein conserved in archaea [Func	85.22
KOG0206		1151	consensus P-type ATPase [General function predicti	85.17
KOG0204		1034	consensus Calcium transporting ATPase [Inorganic i	85.14
PF04312		138	DUF460: Protein of unknown function (DUF460); Inte	84.86
PF11533		125	DUF3225: Protein of unknown function (DUF3225); In	84.72
cd00781		122	ketosteroid_isomerase ketosteroid isomerase: Many	84.34
PLN02177		497	glycerol-3-phosphate acyltransferase	83.22
TIGR01490		202	HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol	81.62

>PLN02382 probable sucrose-phosphatase	Back alignment and domain information

Probab=100.00  E-value=7.5e-101  Score=773.97  Aligned_cols=411  Identities=73%  Similarity=1.225  Sum_probs=384.0

Q ss_pred             CCccccCCCeEEEEeCCCCCCCCCCCCCccHHHHHHHHHHHHcCCcEEEEEcCCCHHHHHHHHHhCCCCCCCEEEEccCc
Q 014649            1 MDRLSAAARLMIVSDLDHTMVDHHDAENLSLLRFNALWEAHYRRDSLLVFSTGRSPTLYKQLRKEKPMLTPDITIMSVGT   80 (421)
Q Consensus         1 M~rl~~~~~klI~~DLDGTLl~~~~~~~~s~~~~~al~~~l~~~g~~vviaTGRs~~~~~~l~~~~~~~~~d~~I~~nGa   80 (421)
                      |+||+++++.||++||||||++++++.+.+..++++++++++++|+.|+++|||++..+..+++.+++..|+++|++||+
T Consensus         1 ~~~~~~~~~~lI~sDLDGTLL~~~~~~~~s~~~~~~l~~~~~~~gi~fv~aTGR~~~~~~~l~~~~~l~~p~~~I~~nGt   80 (413)
T PLN02382          1 MDRLSGSPRLMIVSDLDHTMVDHHDPENLSLLRFNALWEAEYRHDSLLVFSTGRSPTLYKELRKEKPLLTPDITIMSVGT   80 (413)
T ss_pred             CCcccCCCCEEEEEcCCCcCcCCCCccchhHHHHHHHHHHhhcCCeeEEEEcCCCHHHHHHHHHhCCCCCCCEEEEcCCc
Confidence            89999999999999999999988654467778899998789999999999999999999999999999999999999999


Q ss_pred             EEEeCCccCCcccHHHHHhchhhhhHHHHHhhcCCCCcccCCcCCCceEEEEEEcccchHHHHHHHHHHHHhcCCcEEEE
Q 014649           81 EITYGDAMVPDNGWVEVLNQKWDKKIVTEEASRFPELKLQSETEQRPHKVSFYVDKDKAQTVTQKLSEIFKNRGLDVKII  160 (421)
Q Consensus        81 ~I~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~ki~~~~~~~~~~~~~~~l~~~l~~~~~~~~v~  160 (421)
                      .|++++.+.++..|..+++..|.+..+.+....++.+.+++..++.++|++++.+++....+...+.+.+.+.+.++.++
T Consensus        81 ~I~~~~~~~~d~~w~~~l~~~w~~~~v~~~~~~~~~l~~q~~~~~~~~Ki~~~~~~~~~~~~~~~l~~~~~~~g~~~~i~  160 (413)
T PLN02382         81 EIAYGESMVPDHGWVEYLNKKWDREIVVEETSKFPELKLQPETEQRPHKVSFYVDKKKAQEVIKELSERLEKRGLDVKII  160 (413)
T ss_pred             EEEeCCCCccChhHHHHHhccCChhhHHHHHhcCCCcccCCcccCCCeEEEEEechHHhHHHHHHHHHHHHhcCCcEEEE
Confidence            99998888888899999999998876767677787777777777889999998876555566677888787667788888


Q ss_pred             EEcCeeEEEecCCCCHHHHHHHHHHHHhhCCCCCCcEEEEcCCcCchhhhcCCCceEEEecCChHHHHHHHHhhcCCCCc
Q 014649          161 YSGGMDLDILPQGAGKGQALAYLLRKFKCEGKVPTNTLVCGDSGNDAELFSIPEVYGVMVSNAQEELLQWHAANAKNNPK  240 (421)
Q Consensus       161 ~s~~~~ldI~p~g~sKg~al~~L~~~l~~~gi~~~~vl~~GDs~NDi~M~~~agv~gvav~NA~~elk~~a~~v~~~~~~  240 (421)
                      ++++.++||+|+++|||.||++|+++++..|++++++++||||.||++||+.+|++||||+||.+++|++|++++.++++
T Consensus       161 ~s~~~~ldI~p~g~sKg~Al~~L~~~~~~~gi~~~~~iafGDs~NDleMl~~ag~~gvam~NA~~elk~~a~~~~~~~~~  240 (413)
T PLN02382        161 YSGGIDLDVLPQGAGKGQALAYLLKKLKAEGKAPVNTLVCGDSGNDAELFSVPDVYGVMVSNAQEELLQWYAENAKDNPK  240 (413)
T ss_pred             EECCcEEEEEeCCCCHHHHHHHHHHHhhhcCCChhcEEEEeCCHHHHHHHhcCCCCEEEEcCCcHHHHHHHHhhccCCCc
Confidence            99999999999999999999999999966689999999999999999999999956999999999999999999988889


Q ss_pred             eeeccCCCccHHHHHHHHhhCCCCCCCCCCCCCCCCccccCCchhHHHHHHHHHHHHhcccccCCHHHHHHHHhccCCCc
Q 014649          241 LTHATERCAAGIIQAIGHFKLGPSTSPRDIKDESDGEVKSIDLGHEVVKLYLFYERWRRAEIDNSEIYLSSLKANCCPSG  320 (421)
Q Consensus       241 ~~~~~~~~~~GV~~~l~~~~l~~~~~~r~~~~~~~~~~~~~~~~~evv~~~~~~e~w~~~~~~~~~~~~~~l~~~~~p~~  320 (421)
                      ++++++++++||+++|++|.|+||+||||+.+|++++++..+|+||||+||++||+||+||||+++++|++||++|+|+|
T Consensus       241 ~~~a~~~~~~GI~~al~~f~l~~~~~~~~~~~~~~~~~~~~~~~~evv~~~~~~e~W~~~~~~~~~~~~~~l~~~~~p~~  320 (413)
T PLN02382        241 IIHATERCAAGIIQAIGHFNLGPNVSPRDVSDFLYGKLDNVNPAHEVVKFYLFYEKWRRGEVENSDEVFQRLKSSCAPNG  320 (413)
T ss_pred             EEEcCCCCccHHHHHHHHhCCCCCCChhhcccccccccccCCcHHHHHHHHHHHHHHhcCCCCCcHHHHHHHHHhcCCCe
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eEeCCCCcccCHHHHHHHHHhhcCCCCCceEEEEEeeeEEeeeeCCeEEEEEeeeEEeCcceeeEEEEEEEEEeC--CCC
Q 014649          321 FCVPPSGGEISLAEAINQFRKCYGDKQGKQFRVWVDRVLSTEIGPGTWLVKFHKWELSGEERACSIVSIIVRIKD--ASD  398 (421)
Q Consensus       321 ~~v~~~G~~~~~~~~~~~~~~~~g~~~g~~~~i~vd~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~t~~~~~~~--~~~  398 (421)
                      |||||+|+++|++++++.|+++||+||||+||||||++++++.++++|||||+|||+++++++||+|||||++|+  ++|
T Consensus       321 ~~v~p~G~~~~~~~~~~~~~~~~G~~~g~~~~i~vd~~~~~~~~~~~~~v~~~e~q~~~~~~~~~~ttavl~~~~~~~~~  400 (413)
T PLN02382        321 VFVHPSGVEKSLHDSIDELRSCYGDKKGKKFRVWVDRVLSTQLGPDTWLVKFDKWEQSGDERKCCLTTALLTSKEDTPNG  400 (413)
T ss_pred             eEECCCcccCCHHHHHHHHHHhhCCCCCCEEEEEEeeEEEEEEcCCeEEEEEeeeeecCCcceeEEEEEEEeeCCCCCCC
Confidence            999999999999999999999999999999999999999999999999999999999999999999999999987  999


Q ss_pred             eeEEEeeeecccC
Q 014649          399 HTYMHVHETWLEG  411 (421)
Q Consensus       399 ~~w~h~het~~~~  411 (421)
                      ++|+||||||++|
T Consensus       401 ~~W~hlheTw~~~  413 (413)
T PLN02382        401 LEWMHVHQTWLEG  413 (413)
T ss_pred             eEEEEeeecccCC
Confidence            9999999999986

>PF08472 S6PP_C: Sucrose-6-phosphate phosphohydrolase C-terminal; InterPro: IPR013679 This is the Sucrose-6-phosphate phosphohydrolase (S6PP or SPP) C-terminal domain [] as found in plant sucrose phosphatases	Back alignment and domain information

>PF05116 S6PP: Sucrose-6F-phosphate phosphohydrolase; InterPro: IPR006380 This family of sequences represent sucrose phosphate phosphohydrolase (SPP) from plants and cyanobacteria []	Back alignment and domain information

>TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase	Back alignment and domain information

>PRK10513 sugar phosphate phosphatase; Provisional	Back alignment and domain information

>PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional	Back alignment and domain information

>PRK10976 putative hydrolase; Provisional	Back alignment and domain information

>TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial	Back alignment and domain information

>COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only]	Back alignment and domain information

>PRK01158 phosphoglycolate phosphatase; Provisional	Back alignment and domain information

>TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily	Back alignment and domain information

>PLN02887 hydrolase family protein	Back alignment and domain information

>PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification []	Back alignment and domain information

>PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional	Back alignment and domain information

>COG4460 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed	Back alignment and domain information

>TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal	Back alignment and domain information

>TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily	Back alignment and domain information

>TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family	Back alignment and domain information

>PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed	Back alignment and domain information

>PTZ00174 phosphomannomutase; Provisional	Back alignment and domain information

>PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional	Back alignment and domain information

>TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB	Back alignment and domain information

>TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein	Back alignment and domain information

>PRK10187 trehalose-6-phosphate phosphatase; Provisional	Back alignment and domain information

>PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed	Back alignment and domain information

>TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant	Back alignment and domain information

>TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase	Back alignment and domain information

>PLN02423 phosphomannomutase	Back alignment and domain information

>PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional	Back alignment and domain information

>TIGR00685 T6PP trehalose-phosphatase	Back alignment and domain information

>PLN02580 trehalose-phosphatase	Back alignment and domain information

>PLN02205 alpha,alpha-trehalose-phosphate synthase [UDP-forming]	Back alignment and domain information

>COG3769 Predicted hydrolase (HAD superfamily) [General function prediction only]	Back alignment and domain information

>PLN03017 trehalose-phosphatase	Back alignment and domain information

>PLN02151 trehalose-phosphatase	Back alignment and domain information

>TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit	Back alignment and domain information

>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family	Back alignment and domain information

>PF02358 Trehalose_PPase: Trehalose-phosphatase; InterPro: IPR003337 Trehalose-phosphatases 3	Back alignment and domain information

>COG1877 OtsB Trehalose-6-phosphatase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional	Back alignment and domain information

>PLN03063 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional	Back alignment and domain information

>PLN03064 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional	Back alignment and domain information

>PRK11133 serB phosphoserine phosphatase; Provisional	Back alignment and domain information

>COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only]	Back alignment and domain information

>KOG3189 consensus Phosphomannomutase [Lipid transport and metabolism]	Back alignment and domain information

>COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism]	Back alignment and domain information

>cd01427 HAD_like Haloacid dehalogenase-like hydrolases	Back alignment and domain information

>COG0546 Gph Predicted phosphatases [General function prediction only]	Back alignment and domain information

>PF03332 PMM: Eukaryotic phosphomannomutase; InterPro: IPR005002 This enzyme (5	Back alignment and domain information

>TIGR00338 serB phosphoserine phosphatase SerB	Back alignment and domain information

>TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457	Back alignment and domain information

>PRK13288 pyrophosphatase PpaX; Provisional	Back alignment and domain information

>PRK13223 phosphoglycolate phosphatase; Provisional	Back alignment and domain information

>PRK10826 2-deoxyglucose-6-phosphatase; Provisional	Back alignment and domain information

>TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal	Back alignment and domain information

>PRK13226 phosphoglycolate phosphatase; Provisional	Back alignment and domain information

>PRK10444 UMP phosphatase; Provisional	Back alignment and domain information

>KOG1050 consensus Trehalose-6-phosphate synthase component TPS1 and related subunits [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional	Back alignment and domain information

>TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family	Back alignment and domain information

>PRK11590 hypothetical protein; Provisional	Back alignment and domain information

>PRK13222 phosphoglycolate phosphatase; Provisional	Back alignment and domain information

>TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458	Back alignment and domain information

>TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase	Back alignment and domain information

>PLN02770 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein	Back alignment and domain information

>PRK13225 phosphoglycolate phosphatase; Provisional	Back alignment and domain information

>PRK13478 phosphonoacetaldehyde hydrolase; Provisional	Back alignment and domain information

>TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA	Back alignment and domain information

>PLN02575 haloacid dehalogenase-like hydrolase	Back alignment and domain information

>PLN03243 haloacid dehalogenase-like hydrolase; Provisional	Back alignment and domain information

>TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic	Back alignment and domain information

>PRK11587 putative phosphatase; Provisional	Back alignment and domain information

>smart00775 LNS2 LNS2 domain	Back alignment and domain information

>PLN02779 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>PRK14988 GMP/IMP nucleotidase; Provisional	Back alignment and domain information

>TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like	Back alignment and domain information

>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein	Back alignment and domain information

>TIGR03351 PhnX-like phosphonatase-like hydrolase	Back alignment and domain information

>PRK13582 thrH phosphoserine phosphatase; Provisional	Back alignment and domain information

>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253	Back alignment and domain information

>TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain	Back alignment and domain information

>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase	Back alignment and domain information

>PLN02645 phosphoglycolate phosphatase	Back alignment and domain information

>PLN02954 phosphoserine phosphatase	Back alignment and domain information

>TIGR01990 bPGM beta-phosphoglucomutase	Back alignment and domain information

>TIGR01684 viral_ppase viral phosphatase	Back alignment and domain information

>PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated	Back alignment and domain information

>TIGR01664 DNA-3'-Pase DNA 3'-phosphatase	Back alignment and domain information

>TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC	Back alignment and domain information

>PLN02940 riboflavin kinase	Back alignment and domain information

>TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase	Back alignment and domain information

>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase	Back alignment and domain information

>TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II	Back alignment and domain information

>TIGR01261 hisB_Nterm histidinol-phosphatase	Back alignment and domain information

>PHA02597 30	Back alignment and domain information

>TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase	Back alignment and domain information

>PRK10563 6-phosphogluconate phosphatase; Provisional	Back alignment and domain information

>TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase	Back alignment and domain information

>PRK06769 hypothetical protein; Validated	Back alignment and domain information

>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459	Back alignment and domain information

>TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E	Back alignment and domain information

>PHA03398 viral phosphatase superfamily protein; Provisional	Back alignment and domain information

>PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed	Back alignment and domain information

>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated	Back alignment and domain information

>PRK08238 hypothetical protein; Validated	Back alignment and domain information

>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548	Back alignment and domain information

>PRK09449 dUMP phosphatase; Provisional	Back alignment and domain information

>COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only]	Back alignment and domain information

>TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA	Back alignment and domain information

>TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668	Back alignment and domain information

>PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional	Back alignment and domain information

>TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB	Back alignment and domain information

>PHA02530 pseT polynucleotide kinase; Provisional	Back alignment and domain information

>PRK11009 aphA acid phosphatase/phosphotransferase; Provisional	Back alignment and domain information

>PRK10748 flavin mononucleotide phosphatase; Provisional	Back alignment and domain information

>TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase	Back alignment and domain information

>TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase	Back alignment and domain information

>TIGR01685 MDP-1 magnesium-dependent phosphatase-1	Back alignment and domain information

>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254	Back alignment and domain information

>PRK09456 ?-D-glucose-1-phosphatase; Provisional	Back alignment and domain information

>PLN02919 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase	Back alignment and domain information

>TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase	Back alignment and domain information

>PF13474 SnoaL_3: SnoaL-like domain; PDB: 2GXF_A 3KSP_A 3KE7_A 3BB9_E 3CNX_A 3F7S_A 3GWR_B	Back alignment and domain information

>TIGR01106 ATPase-IIC_X-K sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit	Back alignment and domain information

>smart00577 CPDc catalytic domain of ctd-like phosphatases	Back alignment and domain information

>COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK10671 copA copper exporting ATPase; Provisional	Back alignment and domain information

>PF14534 DUF4440: Domain of unknown function (DUF4440); PDB: 3HX8_A 3SOY_A 3ROB_B 3GZR_A 3B7C_A 3CU3_A 3FSD_A 2R4I_C 1TP6_A	Back alignment and domain information

>COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR01523 ATPase-IID_K-Na potassium and/or sodium efflux P-type ATPase, fungal-type	Back alignment and domain information

>COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only]	Back alignment and domain information

>TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672	Back alignment and domain information

>TIGR01686 FkbH FkbH-like domain	Back alignment and domain information

>TIGR01517 ATPase-IIB_Ca plasma-membrane calcium-translocating P-type ATPase	Back alignment and domain information

>COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only]	Back alignment and domain information

>TIGR01647 ATPase-IIIA_H plasma-membrane proton-efflux P-type ATPase	Back alignment and domain information

>TIGR01524 ATPase-IIIB_Mg magnesium-translocating P-type ATPase	Back alignment and domain information

>TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase	Back alignment and domain information

>TIGR01497 kdpB K+-transporting ATPase, B subunit	Back alignment and domain information

>TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase	Back alignment and domain information

>PRK01122 potassium-transporting ATPase subunit B; Provisional	Back alignment and domain information

>PRK10517 magnesium-transporting ATPase MgtA; Provisional	Back alignment and domain information

>TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase	Back alignment and domain information

>PRK15122 magnesium-transporting ATPase; Provisional	Back alignment and domain information

>TIGR01116 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium-translocating P-type ATPase	Back alignment and domain information

>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase	Back alignment and domain information

>PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase)	Back alignment and domain information

>PRK14010 potassium-transporting ATPase subunit B; Provisional	Back alignment and domain information

>TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490	Back alignment and domain information

>PF13242 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A 2HX1_D 2X4D_A 3HLT_C 3L1U_B	Back alignment and domain information

>KOG3040 consensus Predicted sugar phosphatase (HAD superfamily) [General function prediction only]	Back alignment and domain information

>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional	Back alignment and domain information

>COG0474 MgtA Cation transport ATPase [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544	Back alignment and domain information

>TIGR01657 P-ATPase-V P-type ATPase of unknown pump specificity (type V)	Back alignment and domain information

>PTZ00445 p36-lilke protein; Provisional	Back alignment and domain information

>PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea	Back alignment and domain information

>PF08235 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 This domain is found in Saccharomyces cerevisiae (Baker's yeast) protein SMP2, proteins with an N-terminal lipin domain (IPR007651 from INTERPRO) and phosphatidylinositol transfer proteins []	Back alignment and domain information

>PF06437 ISN1: IMP-specific 5'-nucleotidase; InterPro: IPR009453 The Saccharomyces cerevisiae ISN1 (YOR155c) gene encodes an IMP-specific 5'-nucleotidase, which catalyses degradation of IMP to inosine as part of the purine salvage pathway	Back alignment and domain information

>PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A	Back alignment and domain information

>TIGR01675 plant-AP plant acid phosphatase	Back alignment and domain information

>TIGR01652 ATPase-Plipid phospholipid-translocating P-type ATPase, flippase	Back alignment and domain information

>COG4087 Soluble P-type ATPase [General function prediction only]	Back alignment and domain information

>TIGR02246 conserved hypothetical protein	Back alignment and domain information

>TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase	Back alignment and domain information

>PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin []	Back alignment and domain information

>TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family	Back alignment and domain information

>COG4359 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A	Back alignment and domain information

>PLN03190 aminophospholipid translocase; Provisional	Back alignment and domain information

>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED	Back alignment and domain information

>KOG0203 consensus Na+/K+ ATPase, alpha subunit [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG0202 consensus Ca2+ transporting ATPase [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG2116 consensus Protein involved in plasmid maintenance/nuclear protein involved in lipid metabolism [Cell motility; Lipid transport and metabolism]	Back alignment and domain information

>PLN02811 hydrolase	Back alignment and domain information

>PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B	Back alignment and domain information

>KOG0210 consensus P-type ATPase [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5	Back alignment and domain information

>PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25)	Back alignment and domain information

>PF05152 DUF705: Protein of unknown function (DUF705); InterPro: IPR007827 This family contains uncharacterised baculoviral proteins	Back alignment and domain information

>PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases	Back alignment and domain information

>TIGR01680 Veg_Stor_Prot vegetative storage protein	Back alignment and domain information

>KOG2914 consensus Predicted haloacid-halidohydrolase and related hydrolases [General function prediction only]	Back alignment and domain information

>KOG3085 consensus Predicted hydrolase (HAD superfamily) [General function prediction only]	Back alignment and domain information

>COG3882 FkbH Predicted enzyme involved in methoxymalonyl-ACP biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>TIGR01494 ATPase_P-type ATPase, P-type (transporting), HAD superfamily, subfamily IC	Back alignment and domain information

>COG5083 SMP2 Uncharacterized protein involved in plasmid maintenance [General function prediction only]	Back alignment and domain information

>PF12680 SnoaL_2: SnoaL-like domain; PDB: 3F40_A 3RGA_A 3G8Z_A 3DMC_A 3FH1_A 1TUH_A 3F14_A 3ER7_A 1Z1S_A 3F7X_A	Back alignment and domain information

>PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear	Back alignment and domain information

>TIGR02251 HIF-SF_euk Dullard-like phosphatase domain	Back alignment and domain information

>TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain	Back alignment and domain information

>COG4319 Ketosteroid isomerase homolog [Function unknown]	Back alignment and domain information

>COG4996 Predicted phosphatase [General function prediction only]	Back alignment and domain information

>PF08332 CaMKII_AD: Calcium/calmodulin dependent protein kinase II Association; InterPro: IPR013543 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases	Back alignment and domain information

>TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase	Back alignment and domain information

>COG3700 AphA Acid phosphatase (class B) [General function prediction only]	Back alignment and domain information

>PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 []	Back alignment and domain information

>KOG0209 consensus P-type ATPase [Inorganic ion transport and metabolism]	Back alignment and domain information

>PF12893 Lumazine_bd_2: Putative lumazine-binding; PDB: 3BLZ_C 3DUK_F 3FKA_C	Back alignment and domain information

>TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245	Back alignment and domain information

>KOG1615 consensus Phosphoserine phosphatase [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase	Back alignment and domain information

>TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672	Back alignment and domain information

>COG2216 KdpB High-affinity K+ transport system, ATPase chain B [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG3120 consensus Predicted haloacid dehalogenase-like hydrolase [General function prediction only]	Back alignment and domain information

>COG4030 Uncharacterized protein conserved in archaea [Function unknown]	Back alignment and domain information

>KOG0206 consensus P-type ATPase [General function prediction only]	Back alignment and domain information

>KOG0204 consensus Calcium transporting ATPase [Inorganic ion transport and metabolism]	Back alignment and domain information

>PF04312 DUF460: Protein of unknown function (DUF460); InterPro: IPR007408 This is an archaeal protein of unknown function	Back alignment and domain information

>PF11533 DUF3225: Protein of unknown function (DUF3225); InterPro: IPR024507 This family of proteins has no known function	Back alignment and domain information

>cd00781 ketosteroid_isomerase ketosteroid isomerase: Many biological reactions proceed by enzymatic cleavage of a C-H bond adjacent to carbonyl or a carboxyl group, leading to an enol or a enolate intermediate that is subsequently re-protonated at the same or an adjacent carbon	Back alignment and domain information

>PLN02177 glycerol-3-phosphate acyltransferase	Back alignment and domain information

>TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		421
1s2o_A		244	X-Ray Structure Of The Sucrose-Phosphatase (Spp) Fr		8e-38
1rlm_A		271	Crystal Structure Of Ybiv From Escherichia Coli K12		4e-04
3gyg_A		289	Crystal Structure Of Yhjk (Haloacid Dehalogenase-Li		8e-04

>pdb|1S2O|A Chain A, X-Ray Structure Of The Sucrose-Phosphatase (Spp) From Synechocystis Sp. Pcc6803 At 1.40 A Resolution Length = 244

Back alignment and structure

Iteration: 1

Score = 154 bits (389), Expect = 8e-38, Method: Compositional matrix adjust. Identities = 91/253 (35%), Positives = 140/253 (55%), Gaps = 13/253 (5%) Query: 9 RLMIVSDLDHTMVDHHDAENLSLLRFNALWEAHYRRDSLLVFSTGRSPTLYKQLRKEKPM 68 +L+++SDLD+T V A L + R + L ++TGRS ++L+K+ + Sbjct: 3 QLLLISDLDNTWVGDQQA-----LEHLQEYLGDRRGNFYLAYATGRSYHSARELQKQVGL 57 Query: 69 LTPDITIMSVGTEITYGDAMVPDNGWVEVLNQKWDKKIVTEEASRFPELKLQSETEQRPH 128 + PD + +VG+EI + + + D W + L++ W + I+ A F LK QS EQ P Sbjct: 58 MEPDYWLTAVGSEIYHPEGL--DQHWADYLSEHWQRDILQAIADGFEALKPQSPLEQNPW 115 Query: 129 KVSFYVDKDKAQTVTQKLSEIFKNRGLDVKIIYSGGMDLDILPQGAGKGQALAYLLRKFK 188 K+S+++D TV +L+E+ K G+ V++I+S G D+D+LPQ + KG A YL + Sbjct: 116 KISYHLDPQACPTVIDQLTEMLKETGIPVQVIFSSGKDVDLLPQRSNKGNATQYLQQHLA 175 Query: 189 CEGKVPTNTLVCGDSGNDAELFSIPEVYGVMVSNAQEELLQWHAANAKNNPKLTHATERC 248 E P+ TLVCGDSGND LF GV+V NAQ ELL W+ + + + A Sbjct: 176 ME---PSQTLVCGDSGNDIGLFET-SARGVIVRNAQPELLHWY--DQWGDSRHYRAQSSH 229 Query: 249 AAGIIQAIGHFKL 261 A I++AI HF Sbjct: 230 AGAILEAIAHFDF 242

PyMOL of 1s2o

>pdb|1RLM|A Chain A, Crystal Structure Of Ybiv From Escherichia Coli K12 Length = 271

Back alignment and structure

>pdb|3GYG|A Chain A, Crystal Structure Of Yhjk (Haloacid Dehalogenase-Like Hydrolase Protein) From Bacillus Subtilis Length = 289

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		421
1s2o_A		244	SPP, sucrose-phosphatase; phosphohydrolase, HAD su	1e-81
3gyg_A		289	NTD biosynthesis operon putative hydrolase NTDB; P	9e-62
1l6r_A		227	Hypothetical protein TA0175; structural genomics,	3e-19
1wr8_A		231	Phosphoglycolate phosphatase; alpha / beta core do	8e-19
1tp6_A		128	Hypothetical protein PA1314; structural genomics,	5e-18
1rlm_A		271	Phosphatase; HAD family, rossman fold, hydrolase;	2e-16
3l7y_A		304	Putative uncharacterized protein SMU.1108C; hydrol	3e-16
3dao_A		283	Putative phosphatse; structural genomics, joint ce	6e-16
2fue_A		262	PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ	9e-16
1xvi_A		275	MPGP, YEDP, putative mannosyl-3-phosphoglycerate p	3e-14
2zos_A		249	MPGP, mannosyl-3-phosphoglycerate phosphatase; hal	3e-13
3zx4_A		259	MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd	1e-12
2b30_A		301	Pvivax hypothetical protein; SGPP, structural geno	8e-12
4dw8_A		279	Haloacid dehalogenase-like hydrolase; HAD, putativ	2e-11
3pgv_A		285	Haloacid dehalogenase-like hydrolase; structural g	6e-11
3mpo_A		279	Predicted hydrolase of the HAD superfamily; SGX, P	8e-11
1rkq_A		282	Hypothetical protein YIDA; two domain structure wi	9e-11
1nf2_A		268	Phosphatase; structural proteomics, HAD NEW fold,	5e-10
3fzq_A		274	Putative hydrolase; YP_001086940.1, putative haloa	1e-09
3dnp_A		290	Stress response protein YHAX; structural PSI-2, pr	2e-09
2pq0_A		258	Hypothetical conserved protein GK1056; hyopthetica	3e-09
2rbk_A		261	Putative uncharacterized protein; HAD-like phospha	5e-09
3r4c_A		268	Hydrolase, haloacid dehalogenase-like hydrolase; h	6e-09
1nrw_A		288	Hypothetical protein, haloacid dehalogenase-like h	7e-09
2amy_A		246	PMM 2, phosphomannomutase 2; HS.459855, HS.313504,	2e-08
3f9r_A		246	Phosphomannomutase; trypanosome glycobiology struc	4e-07
1u02_A		239	Trehalose-6-phosphate phosphatase related protein;	3e-04

>1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* Length = 244	Back alignment and structure

 Score =  250 bits (640), Expect = 1e-81
 Identities = 90/254 (35%), Positives = 138/254 (54%), Gaps = 13/254 (5%)

Query: 8   ARLMIVSDLDHTMVDHHDAENLSLLRFNALWEAHYRRDSLLVFSTGRSPTLYKQLRKEKP 67
            +L+++SDLD+T V        +L           R +  L ++TGRS    ++L+K+  
Sbjct: 2   RQLLLISDLDNTWVGDQQ----ALEHLQEYLGDR-RGNFYLAYATGRSYHSARELQKQVG 56

Query: 68  MLTPDITIMSVGTEITYGDAMVPDNGWVEVLNQKWDKKIVTEEASRFPELKLQSETEQRP 127
           ++ PD  + +VG+EI + + +  D  W + L++ W + I+   A  F  LK QS  EQ P
Sbjct: 57  LMEPDYWLTAVGSEIYHPEGL--DQHWADYLSEHWQRDILQAIADGFEALKPQSPLEQNP 114

Query: 128 HKVSFYVDKDKAQTVTQKLSEIFKNRGLDVKIIYSGGMDLDILPQGAGKGQALAYLLRKF 187
            K+S+++D     TV  +L+E+ K  G+ V++I+S G D+D+LPQ + KG A  YL +  
Sbjct: 115 WKISYHLDPQACPTVIDQLTEMLKETGIPVQVIFSSGKDVDLLPQRSNKGNATQYLQQHL 174

Query: 188 KCEGKVPTNTLVCGDSGNDAELFSIPEVYGVMVSNAQEELLQWHAANAKNNPKLTHATER 247
             E   P+ TLVCGDSGND  LF      GV+V NAQ ELL W   +   + +   A   
Sbjct: 175 AME---PSQTLVCGDSGNDIGLFETS-ARGVIVRNAQPELLHW--YDQWGDSRHYRAQSS 228

Query: 248 CAAGIIQAIGHFKL 261
            A  I++AI HF  
Sbjct: 229 HAGAILEAIAHFDF 242

PyMOL of 1s2o

>3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} Length = 289	Back alignment and structure

>1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A Length = 227	Back alignment and structure

>1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 Length = 231	Back alignment and structure

>1tp6_A Hypothetical protein PA1314; structural genomics, alpha-beta sandwich, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: d.17.4.12 Length = 128	Back alignment and structure

>1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A Length = 271	Back alignment and structure

>3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} Length = 304	Back alignment and structure

>3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} Length = 283	Back alignment and structure

>2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* Length = 262	Back alignment and structure

>1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 Length = 275	Back alignment and structure

>2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A Length = 249	Back alignment and structure

>3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* Length = 259	Back alignment and structure

>2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 Length = 301	Back alignment and structure

>4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A Length = 279	Back alignment and structure

>3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} Length = 285	Back alignment and structure

>3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} Length = 279	Back alignment and structure

>1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 Length = 282	Back alignment and structure

>1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 Length = 268	Back alignment and structure

>3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} Length = 274	Back alignment and structure

>3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} Length = 290	Back alignment and structure

>2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A Length = 258	Back alignment and structure

>2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A Length = 261	Back alignment and structure

>3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} Length = 268	Back alignment and structure

>1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 Length = 288	Back alignment and structure

>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A Length = 246	Back alignment and structure

>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} PDB: 2i54_A* 2i55_A* Length = 246	Back alignment and structure

>1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 Length = 239	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		421
1s2o_A		244	SPP, sucrose-phosphatase; phosphohydrolase, HAD su	100.0
3dao_A		283	Putative phosphatse; structural genomics, joint ce	100.0
3pgv_A		285	Haloacid dehalogenase-like hydrolase; structural g	100.0
3l7y_A		304	Putative uncharacterized protein SMU.1108C; hydrol	100.0
4dw8_A		279	Haloacid dehalogenase-like hydrolase; HAD, putativ	100.0
3mpo_A		279	Predicted hydrolase of the HAD superfamily; SGX, P	100.0
1tp6_A		128	Hypothetical protein PA1314; structural genomics,	100.0
3dnp_A		290	Stress response protein YHAX; structural PSI-2, pr	100.0
3fzq_A		274	Putative hydrolase; YP_001086940.1, putative haloa	100.0
2pq0_A		258	Hypothetical conserved protein GK1056; hyopthetica	100.0
1rlm_A		271	Phosphatase; HAD family, rossman fold, hydrolase;	100.0
1rkq_A		282	Hypothetical protein YIDA; two domain structure wi	100.0
3r4c_A		268	Hydrolase, haloacid dehalogenase-like hydrolase; h	100.0
2b30_A		301	Pvivax hypothetical protein; SGPP, structural geno	99.98
1nf2_A		268	Phosphatase; structural proteomics, HAD NEW fold,	99.97
1nrw_A		288	Hypothetical protein, haloacid dehalogenase-like h	99.97
1l6r_A		227	Hypothetical protein TA0175; structural genomics,	99.97
1wr8_A		231	Phosphoglycolate phosphatase; alpha / beta core do	99.97
1xvi_A		275	MPGP, YEDP, putative mannosyl-3-phosphoglycerate p	99.96
1u02_A		239	Trehalose-6-phosphate phosphatase related protein;	99.96
3gyg_A		289	NTD biosynthesis operon putative hydrolase NTDB; P	99.96
2rbk_A		261	Putative uncharacterized protein; HAD-like phospha	99.96
2amy_A		246	PMM 2, phosphomannomutase 2; HS.459855, HS.313504,	99.96
2fue_A		262	PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ	99.95
3f9r_A		246	Phosphomannomutase; trypanosome glycobiology struc	99.94
3zx4_A		259	MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd	99.94
2zos_A		249	MPGP, mannosyl-3-phosphoglycerate phosphatase; hal	99.94
3mmz_A		176	Putative HAD family hydrolase; structural genomics	99.76
1k1e_A		180	Deoxy-D-mannose-octulosonate 8-phosphate phosphat;	99.75
1y8a_A		332	Hypothetical protein AF1437; structural genomics,	99.74
3ewi_A		168	N-acylneuraminate cytidylyltransferase; beta barre	99.72
3n07_A		195	3-deoxy-D-manno-octulosonate 8-phosphate phosphat;	99.7
3e8m_A		164	Acylneuraminate cytidylyltransferase; 2-keto-3-deo	99.69
3n1u_A		191	Hydrolase, HAD superfamily, subfamily III A; struc	99.67
3mn1_A		189	Probable YRBI family phosphatase; structural genom	99.65
2p9j_A		162	Hypothetical protein AQ2171; secsg, riken, PSI, st	99.64
3ij5_A		211	3-deoxy-D-manno-octulosonate 8-phosphate phosphat;	99.62
3pdw_A		266	Uncharacterized hydrolase YUTF; structural genomic	99.62
2r8e_A		188	3-deoxy-D-manno-octulosonate 8-phosphate phosphata	99.61
2x4d_A		271	HLHPP, phospholysine phosphohistidine inorganic py	99.58
3qgm_A		268	P-nitrophenyl phosphatase (PHO2); structural genom	99.57
1vjr_A		271	4-nitrophenylphosphatase; TM1742, structural genom	99.54
3epr_A		264	Hydrolase, haloacid dehalogenase-like family; stru	99.53
2c4n_A		250	Protein NAGD; nucleotide phosphatase, HAD superfam	99.52
2wf7_A		221	Beta-PGM, beta-phosphoglucomutase; transition stat	99.51
3iru_A		277	Phoshonoacetaldehyde hydrolase like protein; phosp	99.49
1l7m_A		211	Phosphoserine phosphatase; rossmann fold, four-hel	99.49
3m1y_A		217	Phosphoserine phosphatase (SERB); NYSGXRC, PSI II,	99.48
2oyc_A		306	PLP phosphatase, pyridoxal phosphate phosphatase;	99.44
1te2_A		226	Putative phosphatase; structural genomics, phospha	99.44
3n28_A		335	Phosphoserine phosphatase; HAD family hydrolase, s	99.42
1swv_A		267	Phosphonoacetaldehyde hydrolase; HAD enzyme superf	99.42
3nas_A		233	Beta-PGM, beta-phosphoglucomutase; PSI, structural	99.41
2fdr_A		229	Conserved hypothetical protein; SAD, structural ge	99.39
3mc1_A		226	Predicted phosphatase, HAD family; PSI2, NYSGXRC,	99.39
2ho4_A		259	Haloacid dehalogenase-like hydrolase domain contai	99.38
4ex6_A		237	ALNB; modified rossman fold, phosphatase, magnesiu	99.37
3u26_A		234	PF00702 domain protein; structural genomics, PSI-b	99.36
3kd3_A		219	Phosphoserine phosphohydrolase-like protein; csgid	99.34
3d6j_A		225	Putative haloacid dehalogenase-like hydrolase; str	99.34
3m9l_A		205	Hydrolase, haloacid dehalogenase-like family; HAD	99.31
3s6j_A		233	Hydrolase, haloacid dehalogenase-like family; stru	99.31
3qxg_A		243	Inorganic pyrophosphatase; hydrolase, magnesium bi	99.3
2hcf_A		234	Hydrolase, haloacid dehalogenase-like family; NP_6	99.29
4eek_A		259	Beta-phosphoglucomutase-related protein; hydrolase	99.28
3dv9_A		247	Beta-phosphoglucomutase; structural genomics, APC6	99.28
3umc_A		254	Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru	99.26
3kzx_A		231	HAD-superfamily hydrolase, subfamily IA, variant;	99.26
2gmw_A		211	D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi	99.25
2pib_A		216	Phosphorylated carbohydrates phosphatase TM_1254;	99.24
1yv9_A		264	Hydrolase, haloacid dehalogenase family; hypotheti	99.23
3skx_A		280	Copper-exporting P-type ATPase B; P1B-ATPase, ATP	99.23
2om6_A		235	Probable phosphoserine phosphatase; rossmann fold,	99.22
3ed5_A		238	YFNB; APC60080, bacillus subtilis subsp. subtilis	99.22
2hdo_A		209	Phosphoglycolate phosphatase; NP_784602.1, structu	99.2
3sd7_A		240	Putative phosphatase; structural genomics, haloaci	99.19
2qlt_A		275	(DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac	99.19
2go7_A		207	Hydrolase, haloacid dehalogenase-like family; stru	99.18
2hi0_A		240	Putative phosphoglycolate phosphatase; YP_619066.1	99.18
3l8h_A		179	Putative haloacid dehalogenase-like hydrolase; HAD	99.18
3fvv_A		232	Uncharacterized protein; unknown function, structu	99.17
3p96_A		415	Phosphoserine phosphatase SERB; ssgcid, structural	99.17
3qnm_A		240	Haloacid dehalogenase-like hydrolase; structural g	99.16
2wm8_A		187	MDP-1, magnesium-dependent phosphatase 1; haloacid	99.13
2fi1_A		190	Hydrolase, haloacid dehalogenase-like family; stru	99.13
3e58_A		214	Putative beta-phosphoglucomutase; structu genomics	99.13
2ah5_A		210	COG0546: predicted phosphatases; MCSG, structural	99.13
2pke_A		251	Haloacid delahogenase-like family hydrolase; NP_63	99.12
3l5k_A		250	Protein GS1, haloacid dehalogenase-like hydrolase	99.11
3um9_A		230	Haloacid dehalogenase, type II; haloacid dehalogen	99.11
3umg_A		254	Haloacid dehalogenase; defluorinase, hydrolase; 2.	99.11
3nuq_A		282	Protein SSM1, putative nucleotide phosphatase; sup	99.08
3vay_A		230	HAD-superfamily hydrolase; rossmann fold, haloacid	99.08
3ddh_A		234	Putative haloacid dehalogenase-like family hydrol;	99.08
3umb_A		233	Dehalogenase-like hydrolase; 2.20A {Ralstonia sola	99.05
2no4_A		240	(S)-2-haloacid dehalogenase IVA; HAD superfamily,	99.05
4ap9_A		201	Phosphoserine phosphatase; hydrolase, haloacid deh	99.04
4eze_A		317	Haloacid dehalogenase-like hydrolase; magnesium bi	99.04
3k1z_A		263	Haloacid dehalogenase-like hydrolase domain-conta	99.01
1zjj_A		263	Hypothetical protein PH1952; alpha/beta hydrolase	98.99
3smv_A		240	S-(-)-azetidine-2-carboxylate hydrolase; haloacid	98.97
1qq5_A		253	Protein (L-2-haloacid dehalogenase); hydrolase; 1.	98.94
2hoq_A		241	Putative HAD-hydrolase PH1655; haloacid dehalogena	98.93
1rku_A		206	Homoserine kinase; phosphoserine phosphatase, phos	98.93
2o2x_A		218	Hypothetical protein; structural genomics, joint c	98.93
2pr7_A		137	Haloacid dehalogenase/epoxide hydrolase family; NP	98.92
3cnh_A		200	Hydrolase family protein; NP_295428.1, predicted h	98.91
3ixz_A		1034	Potassium-transporting ATPase alpha; ION pump, H+,	98.89
2nyv_A		222	Pgpase, PGP, phosphoglycolate phosphatase; structu	98.88
2oda_A		196	Hypothetical protein pspto_2114; haloacid dehaloge	98.86
3ib6_A		189	Uncharacterized protein; structural genomics, unkn	98.82
1zrn_A		232	L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud	98.81
2hsz_A		243	Novel predicted phosphatase; structural genomics,	98.81
2w43_A		201	Hypothetical 2-haloalkanoic acid dehalogenase; hyd	98.8
3kbb_A		216	Phosphorylated carbohydrates phosphatase TM_1254;	98.8
4dcc_A		229	Putative haloacid dehalogenase-like hydrolase; mag	98.79
2obb_A		142	Hypothetical protein; structural genomics, PSI-2,	98.78
3rfu_A		736	Copper efflux ATPase; alpha helical, CPC, CXXC, AT	98.77
2hx1_A		284	Predicted sugar phosphatases of the HAD superfamil	98.76
2fpr_A		176	Histidine biosynthesis bifunctional protein HISB;	98.74
3j08_A		645	COPA, copper-exporting P-type ATPase A; copper tra	98.72
3j09_A		723	COPA, copper-exporting P-type ATPase A; copper tra	98.66
4gib_A		250	Beta-phosphoglucomutase; rossmann fold, HAD-like,	98.66
4g9b_A		243	Beta-PGM, beta-phosphoglucomutase; HAD, putative p	98.65
3nvb_A		387	Uncharacterized protein; protein FKBH, protein fkb	98.64
3a1c_A		287	Probable copper-exporting P-type ATPase A; ATP-bin	98.58
1nnl_A		225	L-3-phosphoserine phosphatase; PSP, HPSP, phospho-	98.53
1xpj_A		126	Hypothetical protein; structural genomics, MCSG, p	98.4
3fsd_A		134	NTF2-like protein of unknown function in nutrient;	98.22
3zvl_A		416	Bifunctional polynucleotide phosphatase/kinase; hy	98.21
2yj3_A		263	Copper-transporting ATPase; hydrolase, P-type ATPa	97.48
2b82_A		211	APHA, class B acid phosphatase; DDDD acid phosphat	98.17
3i28_A		555	Epoxide hydrolase 2; aromatic hydrocarbons catabol	98.16
2i7d_A		193	5'(3')-deoxyribonucleotidase, cytosolic type; hydr	98.13
2zg6_A		220	Putative uncharacterized protein ST2620, probable	98.06
2r4i_A		123	Uncharacterized protein; NTF2-like protein, struct	98.05
3ksp_A		129	Calcium/calmodulin-dependent kinase II associatio;	98.03
2zxe_A		1028	Na, K-ATPase alpha subunit; membrane protein, ION	97.96
2p11_A		231	Hypothetical protein; putative haloacid dehalogena	97.93
3kc2_A		352	Uncharacterized protein YKR070W; HAD-like, mitocho	97.89
2i6x_A		211	Hydrolase, haloacid dehalogenase-like family; HAD	97.89
3ar4_A		995	Sarcoplasmic/endoplasmic reticulum calcium ATPase;	97.82
2i33_A		258	Acid phosphatase; HAD superfamily, hydrolase; 1.57	97.82
1mhs_A		920	Proton pump, plasma membrane ATPase; ION transport	97.73
3gwr_A		144	Putative calcium/calmodulin-dependent protein KIN	97.69
2f86_B		143	Hypothetical protein K11E8.1D; UNC-43, oligomeriza	97.6
2b0c_A		206	Putative phosphatase; alpha-D-glucose-1-phosphate,	97.58
3ke7_A		134	Putative ketosteroid isomerase; structural genomic	97.57
3b8c_A		885	ATPase 2, plasma membrane-type; P-type ATPase, pro	97.49
3cnx_A		170	Uncharacterized protein; putative dehydratase, NTF	97.45
1ltq_A		301	Polynucleotide kinase; phosphatase, alpha/beta, P-	97.44
3f7s_A		142	Uncharacterized NTF2-like protein; structural geno	97.42
3b7c_A		122	Uncharacterized protein; NTF-2 like protein, struc	97.39
3bb9_A		148	Putative orphan protein; structural genomics, join	97.37
3soy_A		145	NTF2-like superfamily protein; structural genomics	97.23
4i4k_A		143	Uncharacterized protein SGCJ; structural genomics,	97.13
2gfh_A		260	Haloacid dehalogenase-like hydrolase domain conta;	97.11
2rcd_A		129	Uncharacterized protein; structural genomics, join	97.11
2ux0_A		143	Calcium-calmodulin dependent protein kinase (CAM I	97.1
3pct_A		260	Class C acid phosphatase; hydrolase, outer membran	96.84
3ocu_A		262	Lipoprotein E; hydrolase, outer membrane; HET: NMN	96.82
3h51_A		156	Putative calcium/calmodulin dependent protein KIN	96.76
3hx8_A		129	MLR2180 protein, putative ketosteroid isomerase; s	96.71
3d9r_A		135	Ketosteroid isomerase-like protein; YP_049581.1, s	96.61
3cu3_A		172	Domain of unknown function with A cystatin-like F;	96.59
4fe3_A		297	Cytosolic 5'-nucleotidase 3; substrate complex, HA	96.5
3rob_A		139	Uncharacterized conserved protein; structural geno	96.48
2fea_A		236	2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate	96.42
3gzr_A		146	Uncharacterized protein with A NTF2-like fold; str	96.09
2owp_A		129	Hypothetical protein BXE_B1374; cystatin-like fold	95.64
1yns_A		261	E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo	95.49
1oh0_A		131	Steroid delta-isomerase; ketosteroid isomerase, KS	95.47
2g80_A		253	Protein UTR4; YEL038W, UTR4 protein (unknown trans	95.37
2gxf_A		142	Hypothetical protein YYBH; alpha-beta protein., st	94.58
2hhl_A		195	CTD small phosphatase-like protein; CTD phosphatas	94.35
3duk_A		125	NTF2-like protein of unknown function; structural	94.12
1qyi_A		384	ZR25, hypothetical protein; structural genomics, P	94.11
1ohp_A		125	Steroid delta-isomerase; inhibitor; HET: ESR; 1.53	93.92
2ght_A		181	Carboxy-terminal domain RNA polymerase II polypept	93.69
3bwv_A		180	Putative 5'(3')-deoxyribonucleotidase; NP_764060.1	93.65
1q92_A		197	5(3)-deoxyribonucleotidase; alpha-beta rossman fol	93.53
2b0c_A		206	Putative phosphatase; alpha-D-glucose-1-phosphate,	93.4
3h3h_A		122	Uncharacterized snoal-like protein; structural gen	93.33
4gxt_A		385	A conserved functionally unknown protein; structur	93.29
2gex_A		152	SNOL; alpha+beta barrel, oxidoreductase; 2.50A {St	93.27
2i6x_A		211	Hydrolase, haloacid dehalogenase-like family; HAD	93.17
2fea_A		236	2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate	92.53
2g80_A		253	Protein UTR4; YEL038W, UTR4 protein (unknown trans	91.98
2a15_A		139	Hypothetical protein RV0760C; beta-alpha-barrel, s	91.89
2gfh_A		260	Haloacid dehalogenase-like hydrolase domain conta;	91.88
3qle_A		204	TIM50P; chaperone, mitochondrion, preprotein trans	91.66
3fka_A		120	Uncharacterized NTF-2 like protein; structural gen	91.34
3k0z_A		159	Putative polyketide cyclase; structural genomics,	91.34
3ebt_A		132	Uncharacterized NTF2-like protein; structural geno	91.21
3ef0_A		372	RNA polymerase II subunit A C-terminal domain phos	91.09
1yns_A		261	E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo	90.49
3blz_A		128	NTF2-like protein of unknown function; structural	89.42
2k54_A		123	Protein ATU0742; protein of unknown function, stru	89.26
3shq_A		320	UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila	88.84
2chc_A		170	Protein RV3472; hypothetical protein; 1.69A {Mycob	88.31
3kkg_A		146	Putative snoal-like polyketide cyclase; structural	88.11
2gey_A		158	ACLR protein; alpha+beta barrel, oxidoreductase; H	87.53
3fh1_A		129	Uncharacterized NTF2-like protein; structural geno	87.24
3hzp_A		131	NTF2-like protein of unknown function; YP_291699.1	87.02
4fe3_A		297	Cytosolic 5'-nucleotidase 3; substrate complex, HA	86.85
1tuh_A		156	BAL32A, hypothetical protein EGC068; unknown funct	86.74
4as2_A		327	Phosphorylcholine phosphatase; hydrolase, HAD supe	85.68
2bng_A		149	MB2760; epoxide hydrolase, limonene, hydrolase, st	85.04
3f40_A		114	Uncharacterized NTF2-like protein; YP_677363.1, NT	84.97
3a1c_A		287	Probable copper-exporting P-type ATPase A; ATP-bin	84.48
3b8l_A		163	Uncharacterized protein; putative aromatic ring hy	84.4
1s5a_A		150	Hypothetical protein YESE; structural genomics, PS	83.88
3dmc_A		134	NTF2-like protein; structural genomics, joint cent	83.47
3ec9_A		140	Uncharacterized NTF2-like protein; structural geno	83.41
2rfr_A		155	Uncharacterized protein; structural genomics, join	83.0
4h3u_A		158	Hypothetical protein; structural genomics, PSI-bio	82.84
1nww_A		149	Limonene-1,2-epoxide hydrolase; HET: MES; 1.20A {R	81.3
1q92_A		197	5(3)-deoxyribonucleotidase; alpha-beta rossman fol	80.99
3hk4_A		136	MLR7391 protein; NTF2-like protein, structural gen	80.49
3g0k_A		148	Putative membrane protein; snoal-like polyketide c	80.09

>1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A*	Back alignment and structure

Probab=100.00  E-value=3e-35  Score=277.01  Aligned_cols=233  Identities=39%  Similarity=0.655  Sum_probs=173.5

Q ss_pred             eEEEEeCCCCCCCCCCCCCccHHHHHHHHHHHHcCCcEEEEEcCCCHHHHHHHHHhCCCCCCCEEEEccCcEEEeCCccC
Q 014649           10 LMIVSDLDHTMVDHHDAENLSLLRFNALWEAHYRRDSLLVFSTGRSPTLYKQLRKEKPMLTPDITIMSVGTEITYGDAMV   89 (421)
Q Consensus        10 klI~~DLDGTLl~~~~~~~~s~~~~~al~~~l~~~g~~vviaTGRs~~~~~~l~~~~~~~~~d~~I~~nGa~I~~~~~~~   89 (421)
                      ++|+|||||||++++.  .+ ....++|. ++ ++|+.|+++|||++..+.++.+.+++..++++|++||+.|++...+ 
T Consensus         4 ~li~~DlDGTLl~~~~--~~-~~~~~~l~-~~-~~gi~v~iaTGR~~~~~~~~~~~l~l~~~~~~I~~NGa~i~~~~~~-   77 (244)
T 1s2o_A            4 LLLISDLDNTWVGDQQ--AL-EHLQEYLG-DR-RGNFYLAYATGRSYHSARELQKQVGLMEPDYWLTAVGSEIYHPEGL-   77 (244)
T ss_dssp             EEEEECTBTTTBSCHH--HH-HHHHHHHH-TT-GGGEEEEEECSSCHHHHHHHHHHHTCCCCSEEEETTTTEEEETTEE-
T ss_pred             eEEEEeCCCCCcCCHH--HH-HHHHHHHH-Hh-cCCCEEEEEcCCCHHHHHHHHHHcCCCCCCEEEECCCcEEEeCCCc-
Confidence            4999999999999752  22 22233443 34 4689999999999999999998877655788999999999874322 


Q ss_pred             CcccHHHHHhchhhhhHHHHHhhcCCCCcccCCcCCCceEEEEEEcccchHHHHHHHHHHHHhcCCcEEEEEEcCeeEEE
Q 014649           90 PDNGWVEVLNQKWDKKIVTEEASRFPELKLQSETEQRPHKVSFYVDKDKAQTVTQKLSEIFKNRGLDVKIIYSGGMDLDI  169 (421)
Q Consensus        90 ~~~~~~~~l~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~ki~~~~~~~~~~~~~~~l~~~l~~~~~~~~v~~s~~~~ldI  169 (421)
                       +..+...+...|....+......++.+...........|+.++..++...+..+.+.+.+.+.+..+.++.|+..++||
T Consensus        78 -~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ki~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~s~~~~lei  156 (244)
T 1s2o_A           78 -DQHWADYLSEHWQRDILQAIADGFEALKPQSPLEQNPWKISYHLDPQACPTVIDQLTEMLKETGIPVQVIFSSGKDVDL  156 (244)
T ss_dssp             -CHHHHHHHHTTCCHHHHHHHHHTCTTEEECCGGGCBTTBEEEEECTTSCTHHHHHHHHHHHTSSCCEEEEEETTTEEEE
T ss_pred             -ChHHHHHHhccccHHHHHHHHHhccCccccCcccCCCeEEEEEeChhhHHHHHHHHHHHHHhcCCCeEEEEecCceEEe
Confidence             2234444444443222222233444433222223457788877655443445566777776544468888898999999


Q ss_pred             ecCCCCHHHHHHHHHHHHhhCCCCCCcEEEEcCCcCchhhhcCCCceEEEecCChHHHHHH-------HHhhcCCCCcee
Q 014649          170 LPQGAGKGQALAYLLRKFKCEGKVPTNTLVCGDSGNDAELFSIPEVYGVMVSNAQEELLQW-------HAANAKNNPKLT  242 (421)
Q Consensus       170 ~p~g~sKg~al~~L~~~l~~~gi~~~~vl~~GDs~NDi~M~~~agv~gvav~NA~~elk~~-------a~~v~~~~~~~~  242 (421)
                      +|++++|+.|++++++++   |++++++++||||.||++||+.+| ++|+|+||.+++|++       |++++.++    
T Consensus       157 ~~~~~~K~~~l~~l~~~~---~~~~~~~~~~GD~~nD~~m~~~~g-~~va~~na~~~~k~~a~~~~~~a~~v~~~~----  228 (244)
T 1s2o_A          157 LPQRSNKGNATQYLQQHL---AMEPSQTLVCGDSGNDIGLFETSA-RGVIVRNAQPELLHWYDQWGDSRHYRAQSS----  228 (244)
T ss_dssp             EETTCSHHHHHHHHHHHT---TCCGGGEEEEECSGGGHHHHTSSS-EEEECTTCCHHHHHHHHHHCCTTEEECSSC----
T ss_pred             ccCCCChHHHHHHHHHHh---CCCHHHEEEECCchhhHHHHhccC-cEEEEcCCcHHHHHHHhcccccceeecCCc----
Confidence            999999999999999999   999999999999999999999999 899999999999997       44555543    


Q ss_pred             eccCCCccHHHHHHHHhhCC
Q 014649          243 HATERCAAGIIQAIGHFKLG  262 (421)
Q Consensus       243 ~~~~~~~~GV~~~l~~~~l~  262 (421)
                           +++||+++|++|.+.
T Consensus       229 -----~~dGva~~i~~~~li  243 (244)
T 1s2o_A          229 -----HAGAILEAIAHFDFL  243 (244)
T ss_dssp             -----HHHHHHHHHHHTTCC
T ss_pred             -----chhHHHHHHHHhccc
Confidence                 589999999999864

PyMOL of 1s2o

>3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale}	Back alignment and structure

>3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp}	Back alignment and structure

>3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans}	Back alignment and structure

>4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A	Back alignment and structure

>3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0	Back alignment and structure

>1tp6_A Hypothetical protein PA1314; structural genomics, alpha-beta sandwich, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: d.17.4.12	Back alignment and structure

>3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0	Back alignment and structure

>3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0	Back alignment and structure

>2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A	Back alignment and structure

>1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A	Back alignment and structure

>1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10	Back alignment and structure

>3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0	Back alignment and structure

>2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10	Back alignment and structure

>1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10	Back alignment and structure

>1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10	Back alignment and structure

>1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A	Back alignment and structure

>1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10	Back alignment and structure

>1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10	Back alignment and structure

>1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15	Back alignment and structure

>3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp}	Back alignment and structure

>2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A	Back alignment and structure

>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A	Back alignment and structure

>2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A*	Back alignment and structure

>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A*	Back alignment and structure

>3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A*	Back alignment and structure

>2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A	Back alignment and structure

>3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis}	Back alignment and structure

>1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A*	Back alignment and structure

>1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24	Back alignment and structure

>3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus}	Back alignment and structure

>3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae}	Back alignment and structure

>3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A*	Back alignment and structure

>3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0	Back alignment and structure

>3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A	Back alignment and structure

>2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus}	Back alignment and structure

>3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis}	Back alignment and structure

>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0	Back alignment and structure

>2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A*	Back alignment and structure

>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens}	Back alignment and structure

>3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0	Back alignment and structure

>1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A*	Back alignment and structure

>3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A	Back alignment and structure

>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14	Back alignment and structure

>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A	Back alignment and structure

>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0	Back alignment and structure

>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A*	Back alignment and structure

>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0	Back alignment and structure

>2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A*	Back alignment and structure

>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6	Back alignment and structure

>3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae}	Back alignment and structure

>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A	Back alignment and structure

>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis}	Back alignment and structure

>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6	Back alignment and structure

>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0	Back alignment and structure

>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A	Back alignment and structure

>4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A	Back alignment and structure

>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A	Back alignment and structure

>3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp}	Back alignment and structure

>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343}	Back alignment and structure

>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A*	Back alignment and structure

>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV}	Back alignment and structure

>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A	Back alignment and structure

>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6	Back alignment and structure

>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A	Back alignment and structure

>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus}	Back alignment and structure

>3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa}	Back alignment and structure

>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis}	Back alignment and structure

>2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A*	Back alignment and structure

>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14	Back alignment and structure

>3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A*	Back alignment and structure

>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii}	Back alignment and structure

>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A	Back alignment and structure

>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6	Back alignment and structure

>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile}	Back alignment and structure

>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae}	Back alignment and structure

>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6	Back alignment and structure

>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii}	Back alignment and structure

>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica}	Back alignment and structure

>3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis}	Back alignment and structure

>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium}	Back alignment and structure

>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0	Back alignment and structure

>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A	Back alignment and structure

>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3	Back alignment and structure

>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311}	Back alignment and structure

>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6	Back alignment and structure

>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV}	Back alignment and structure

>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens}	Back alignment and structure

>3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP}	Back alignment and structure

>3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii}	Back alignment and structure

>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A*	Back alignment and structure

>3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV}	Back alignment and structure

>3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum}	Back alignment and structure

>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A*	Back alignment and structure

>4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A	Back alignment and structure

>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp}	Back alignment and structure

>3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens}	Back alignment and structure

>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii}	Back alignment and structure

>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas}	Back alignment and structure

>1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A	Back alignment and structure

>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii}	Back alignment and structure

>1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A	Back alignment and structure

>2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19	Back alignment and structure

>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1}	Back alignment and structure

>3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2yn9_A 2xzb_A 1iwc_A 1iwf_A	Back alignment and structure

>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A	Back alignment and structure

>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV}	Back alignment and structure

>3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes}	Back alignment and structure

>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A	Back alignment and structure

>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6	Back alignment and structure

>2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A	Back alignment and structure

>3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8}	Back alignment and structure

>4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A	Back alignment and structure

>2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25	Back alignment and structure

>3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp}	Back alignment and structure

>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii}	Back alignment and structure

>2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A*	Back alignment and structure

>3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus}	Back alignment and structure

>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus}	Back alignment and structure

>4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile}	Back alignment and structure

>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli}	Back alignment and structure

>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I	Back alignment and structure

>1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A	Back alignment and structure

>1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18	Back alignment and structure

>3fsd_A NTF2-like protein of unknown function in nutrient; YP_427473.1, NTF2-like protein of unknown function in nutrie uptake; HET: UNL; 1.70A {Rhodospirillum rubrum atcc 11170} SCOP: d.17.4.0	Back alignment and structure

>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A*	Back alignment and structure

>2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A*	Back alignment and structure

>2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A	Back alignment and structure

>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A*	Back alignment and structure

>2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A*	Back alignment and structure

>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii}	Back alignment and structure

>2r4i_A Uncharacterized protein; NTF2-like protein, structural genomics, joint center for STR genomics, JCSG; HET: MSE CIT; 1.60A {Cytophaga hutchinsonii atcc 33406} SCOP: d.17.4.15	Back alignment and structure

>3ksp_A Calcium/calmodulin-dependent kinase II associatio; cystatin-like fold, structural genomics, joint center for ST genomics, JCSG; HET: MSE NHE; 2.59A {Exiguobacterium sibiricum 255-15}	Back alignment and structure

>2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A	Back alignment and structure

>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans}	Back alignment and structure

>3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A*	Back alignment and structure

>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis}	Back alignment and structure

>3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ...	Back alignment and structure

>2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A	Back alignment and structure

>1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1	Back alignment and structure

>3gwr_A Putative calcium/calmodulin-dependent protein KIN II association domain; YP_315894.1; HET: MSE PG4; 2.01A {Thiobacillus denitrificans atcc 25259}	Back alignment and structure

>2f86_B Hypothetical protein K11E8.1D; UNC-43, oligomerization domain, transferase; 2.64A {Caenorhabditis elegans} SCOP: d.17.4.7	Back alignment and structure

>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2	Back alignment and structure

>3ke7_A Putative ketosteroid isomerase; structural genomics, joint C structural genomics, JCSG, protein structure initiative; HET: MSE BCN; 1.45A {Parabacteroides distasonis atcc 8503}	Back alignment and structure

>3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana}	Back alignment and structure

>3cnx_A Uncharacterized protein; putative dehydratase, NTF2-like protein, structural genomics center for structural genomics, JCSG; HET: MSE PGE PG6; 2.10A {Streptomyces avermitilis} SCOP: d.17.4.17	Back alignment and structure

>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A	Back alignment and structure

>3f7s_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; 2.11A {Pseudomonas putida KT2440}	Back alignment and structure

>3b7c_A Uncharacterized protein; NTF-2 like protein, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.70A {Shewanella oneidensis} SCOP: d.17.4.16	Back alignment and structure

>3bb9_A Putative orphan protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.80A {Shewanella frigidimarina} SCOP: d.17.4.16	Back alignment and structure

>3soy_A NTF2-like superfamily protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.00A {Salmonella enterica subsp}	Back alignment and structure

>4i4k_A Uncharacterized protein SGCJ; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: CIT PG4 1PE; 1.70A {Streptomyces globisporus}	Back alignment and structure

>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A	Back alignment and structure

>2rcd_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.32A {Pectobacterium atrosepticum SCRI1043} SCOP: d.17.4.18	Back alignment and structure

>2ux0_A Calcium-calmodulin dependent protein kinase (CAM II gamma; transferase, oligomerisation DOM serine- threonine kinase, ATP-binding; 2.46A {Homo sapiens} SCOP: d.17.4.7 PDB: 2w2c_A 1hkx_A*	Back alignment and structure

>3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida}	Back alignment and structure

>3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A	Back alignment and structure

>3h51_A Putative calcium/calmodulin dependent protein KIN association domain; NP_636218.1; HET: MSE PG4; 1.70A {Xanthomonas campestris PV}	Back alignment and structure

>3hx8_A MLR2180 protein, putative ketosteroid isomerase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE UNL PG4; 1.45A {Mesorhizobium loti}	Back alignment and structure

>3d9r_A Ketosteroid isomerase-like protein; YP_049581.1, structural joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.40A {Pectobacterium atrosepticum} SCOP: d.17.4.27	Back alignment and structure

>3cu3_A Domain of unknown function with A cystatin-like F; structural genomics, joint center for structural genomics, J protein structure initiative; 2.00A {Nostoc punctiforme} SCOP: d.17.4.28	Back alignment and structure

>4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A	Back alignment and structure

>3rob_A Uncharacterized conserved protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.48A {Planctomyces limnophilus}	Back alignment and structure

>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20	Back alignment and structure

>3gzr_A Uncharacterized protein with A NTF2-like fold; structural genomics, joint center for struct genomics, JCSG, protein structure initiative; HET: MSE GOL; 1.40A {Caulobacter vibrioides}	Back alignment and structure

>2owp_A Hypothetical protein BXE_B1374; cystatin-like fold, DUF3225 family protein, structural genom joint center for structural genomics, JCSG; 2.00A {Burkholderia xenovorans} SCOP: d.17.4.18	Back alignment and structure

>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A	Back alignment and structure

>1oh0_A Steroid delta-isomerase; ketosteroid isomerase, KSI, equilenin, PI, LBHB; HET: EQU; 1.1A {Pseudomonas putida} SCOP: d.17.4.3 PDB: 1e3v_A* 1opy_A 1dmq_A 1dmm_A 1ea2_A 3cpo_A 1e3r_A* 1ogx_A 2inx_A 2pzv_A 1c7h_A 1dmn_A 1k41_A 1oho_A* 3fzw_A* 1cqs_A* 1w00_A 1e97_A 1w6y_A* 3ipt_A* ...	Back alignment and structure

>2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22	Back alignment and structure

>2gxf_A Hypothetical protein YYBH; alpha-beta protein., structural genomics, PSI, protein structure initiative; HET: MES; 3.10A {Bacillus subtilis} SCOP: d.17.4.22	Back alignment and structure

>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens}	Back alignment and structure

>3duk_A NTF2-like protein of unknown function; structural genomics, joint center for STR genomics, JCSG, protein structure initiative; HET: MSE; 2.20A {Methylobacillus flagellatus KT} SCOP: d.17.4.0	Back alignment and structure

>1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13	Back alignment and structure

>1ohp_A Steroid delta-isomerase; inhibitor; HET: ESR; 1.53A {Pseudomonas testosteroni} SCOP: d.17.4.3 PDB: 1qjg_A* 8cho_A* 1ohs_A* 1ocv_A 1isk_A 3nuv_A* 1ogz_A* 3nhx_A* 3m8c_A* 3nxj_A* 3myt_A* 3mki_A 3mhe_A 1buq_A* 3nbr_A* 3t8u_A 3ov4_A* 3nm2_A	Back alignment and structure

>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A	Back alignment and structure

>3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis}	Back alignment and structure

>1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A	Back alignment and structure

>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2	Back alignment and structure

>3h3h_A Uncharacterized snoal-like protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE UNL MES; 1.60A {Burkholderia thailandensis E264}	Back alignment and structure

>4gxt_A A conserved functionally unknown protein; structural genomics, PSI-biology; 1.82A {Anaerococcus prevotii}	Back alignment and structure

>2gex_A SNOL; alpha+beta barrel, oxidoreductase; 2.50A {Streptomyces nogalater} SCOP: d.17.4.9	Back alignment and structure

>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis}	Back alignment and structure

>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20	Back alignment and structure

>2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22	Back alignment and structure

>2a15_A Hypothetical protein RV0760C; beta-alpha-barrel, structural genomics, PSI, protein structure initiative; 1.68A {Mycobacterium tuberculosis} SCOP: d.17.4.3 PDB: 2z76_A* 2z77_A* 2z7a_A	Back alignment and structure

>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A	Back alignment and structure

>3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118}	Back alignment and structure

>3fka_A Uncharacterized NTF-2 like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.69A {Silicibacter pomeroyi dss-3}	Back alignment and structure

>3k0z_A Putative polyketide cyclase; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative, PS lipoprotein; HET: NHE; 1.91A {Bacillus cereus}	Back alignment and structure

>3ebt_A Uncharacterized NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative; 1.30A {Burkholderia pseudomallei K96243} SCOP: d.17.4.9	Back alignment and structure

>3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe}	Back alignment and structure

>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A	Back alignment and structure

>3blz_A NTF2-like protein of unknown function; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.75A {Shewanella baltica} SCOP: d.17.4.14	Back alignment and structure

>2k54_A Protein ATU0742; protein of unknown function, structural genomics, PSI-2, Pro structure initiative; NMR {Agrobacterium tumefaciens str} SCOP: d.17.4.29	Back alignment and structure

>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster}	Back alignment and structure

>2chc_A Protein RV3472; hypothetical protein; 1.69A {Mycobacterium tuberculosis} SCOP: d.17.4.25	Back alignment and structure

>3kkg_A Putative snoal-like polyketide cyclase; structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2, lyase; HET: MSE PGE; 1.40A {Jannaschia SP}	Back alignment and structure

>2gey_A ACLR protein; alpha+beta barrel, oxidoreductase; HET: PG4; 1.80A {Streptomyces galilaeus} SCOP: d.17.4.9	Back alignment and structure

>3fh1_A Uncharacterized NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.60A {Mesorhizobium loti}	Back alignment and structure

>3hzp_A NTF2-like protein of unknown function; YP_291699.1, structural genomics, joint center structural genomics, JCSG; HET: MSE 1PE; 1.40A {Prochlorococcus marinus}	Back alignment and structure

>4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A	Back alignment and structure

>1tuh_A BAL32A, hypothetical protein EGC068; unknown function; 1.85A {Uncultured bacterium} SCOP: d.17.4.11	Back alignment and structure

>4as2_A Phosphorylcholine phosphatase; hydrolase, HAD superfamily, alkylammonium compounds; HET: BTB; 2.12A {Pseudomonas aeruginosa} PDB: 4as3_A*	Back alignment and structure

>2bng_A MB2760; epoxide hydrolase, limonene, hydrolase, structural proteomics in europe, spine, structural genomics; 2.5A {Mycobacterium tuberculosis} SCOP: d.17.4.8	Back alignment and structure

>3f40_A Uncharacterized NTF2-like protein; YP_677363.1, NTF2-like protein of unknown function, structural genomics; HET: MSE; 1.27A {Cytophaga hutchinsonii atcc 33406}	Back alignment and structure

>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I	Back alignment and structure

>3b8l_A Uncharacterized protein; putative aromatic ring hydroxylase, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.75A {Novosphingobium aromaticivorans} SCOP: d.17.4.28	Back alignment and structure

>1s5a_A Hypothetical protein YESE; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG, U function; 1.70A {Bacillus subtilis} SCOP: d.17.4.10	Back alignment and structure

>3dmc_A NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2, unknow function; 1.65A {Anabaena variabilis atcc 29413} SCOP: d.17.4.10	Back alignment and structure

>3ec9_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.60A {Burkholderia thailandensis E264} SCOP: d.17.4.10	Back alignment and structure

>2rfr_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.16A {Novosphingobium aromaticivorans} SCOP: d.17.4.28	Back alignment and structure

>4h3u_A Hypothetical protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.15A {Catenulispora acidiphila}	Back alignment and structure

>1nww_A Limonene-1,2-epoxide hydrolase; HET: MES; 1.20A {Rhodococcus erythropolis} SCOP: d.17.4.8 PDB: 1nu3_A*	Back alignment and structure

>1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A	Back alignment and structure

>3hk4_A MLR7391 protein; NTF2-like protein, structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2, lyase; HET: MSE; 1.96A {Mesorhizobium loti}	Back alignment and structure

>3g0k_A Putative membrane protein; snoal-like polyketide cyclase, structural genomics, joint CE structural genomics, JCSG; HET: MSE; 1.30A {Novosphingobium aromaticivorans}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		421
d1s2oa1		244	c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {	2e-36
d1tp6a_		126	d.17.4.12 (A:) Hypothetical protein PA1314 {Pseudo	3e-31
d1xvia_		232	c.108.1.10 (A:) Putative mannosyl-3-phosphoglycera	3e-15
d2rbka1		260	c.108.1.10 (A:2-261) Sugar-phosphate phosphatase B	9e-15
d1rlma_		269	c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Esc	4e-13
d1nrwa_		285	c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillu	3e-12
d1wzca1		243	c.108.1.10 (A:1-243) Putative mannosyl-3-phosphogl	4e-12
d1l6ra_		225	c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPa	6e-12
d1rkqa_		271	c.108.1.10 (A:) Hypothetical protein YidA {Escheri	8e-12
d1wr8a_		230	c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPa	5e-10
d2amya1		243	c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (	1e-09
d2b30a1		283	c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmod	2e-09
d2fuea1		244	c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human	3e-09
d1nf2a_		267	c.108.1.10 (A:) Hypothetical protein TM0651 {Therm	2e-07

>d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Length = 244	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: Predicted hydrolases Cof
domain: Sucrose-phosphatase Slr0953
species: Synechocystis sp. pcc 6803 [TaxId: 1148]

 Score =  132 bits (331), Expect = 2e-36
 Identities = 90/253 (35%), Positives = 138/253 (54%), Gaps = 13/253 (5%)

Query: 9   RLMIVSDLDHTMVDHHDAENLSLLRFNALWEAHYRRDSLLVFSTGRSPTLYKQLRKEKPM 68
           +L+++SDLD+T V        +L           R +  L ++TGRS    ++L+K+  +
Sbjct: 3   QLLLISDLDNTWVGDQQ----ALEHLQEYLGDR-RGNFYLAYATGRSYHSARELQKQVGL 57

Query: 69  LTPDITIMSVGTEITYGDAMVPDNGWVEVLNQKWDKKIVTEEASRFPELKLQSETEQRPH 128
           + PD  + +VG+EI + + +  D  W + L++ W + I+   A  F  LK QS  EQ P 
Sbjct: 58  MEPDYWLTAVGSEIYHPEGL--DQHWADYLSEHWQRDILQAIADGFEALKPQSPLEQNPW 115

Query: 129 KVSFYVDKDKAQTVTQKLSEIFKNRGLDVKIIYSGGMDLDILPQGAGKGQALAYLLRKFK 188
           K+S+++D     TV  +L+E+ K  G+ V++I+S G D+D+LPQ + KG A  YL +   
Sbjct: 116 KISYHLDPQACPTVIDQLTEMLKETGIPVQVIFSSGKDVDLLPQRSNKGNATQYLQQHLA 175

Query: 189 CEGKVPTNTLVCGDSGNDAELFSIPEVYGVMVSNAQEELLQWHAANAKNNPKLTHATERC 248
            E   P+ TLVCGDSGND  LF      GV+V NAQ ELL W   +   + +   A    
Sbjct: 176 ME---PSQTLVCGDSGNDIGLFETSA-RGVIVRNAQPELLHW--YDQWGDSRHYRAQSSH 229

Query: 249 AAGIIQAIGHFKL 261
           A  I++AI HF  
Sbjct: 230 AGAILEAIAHFDF 242

PyMOL of d1s2oa1

>d1tp6a_ d.17.4.12 (A:) Hypothetical protein PA1314 {Pseudomonas aeruginosa [TaxId: 287]} Length = 126	Back information, alignment and structure

>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Length = 232	Back information, alignment and structure

>d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 260	Back information, alignment and structure

>d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} Length = 269	Back information, alignment and structure

>d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} Length = 285	Back information, alignment and structure

>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 243	Back information, alignment and structure

>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 225	Back information, alignment and structure

>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Length = 271	Back information, alignment and structure

>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Length = 230	Back information, alignment and structure

>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 243	Back information, alignment and structure

>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} Length = 283	Back information, alignment and structure

>d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 244	Back information, alignment and structure

>d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} Length = 267	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		421
d1tp6a_		126	Hypothetical protein PA1314 {Pseudomonas aeruginos	100.0
d1s2oa1		244	Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc	100.0
d1rkqa_		271	Hypothetical protein YidA {Escherichia coli [TaxId	100.0
d1rlma_		269	Sugar phosphatase SupH (YbiV) {Escherichia coli [T	100.0
d2rbka1		260	Sugar-phosphate phosphatase BT4131 {Bacteroides th	100.0
d1nrwa_		285	Hypothetical protein YwpJ {Bacillus subtilis [TaxI	100.0
d1nf2a_		267	Hypothetical protein TM0651 {Thermotoga maritima [	100.0
d1wr8a_		230	Phosphoglycolate phosphatase, PGPase {Pyrococcus h	99.97
d2b30a1		283	PFL1270w orthologue {Plasmodium vivax [TaxId: 5855	99.97
d1l6ra_		225	Phosphoglycolate phosphatase, PGPase {Archaeon The	99.97
d1wzca1		243	Putative mannosyl-3-phosphoglycerate phosphatase M	99.94
d1xvia_		232	Putative mannosyl-3-phosphoglycerate phosphatase M	99.94
d2fuea1		244	Phosphomannomutase 1 {Human (Homo sapiens) [TaxId:	99.92
d2amya1		243	Phosphomannomutase 2 {Human (Homo sapiens) [TaxId:	99.91
d1u02a_		229	Trehalose-6-phosphate phosphatase related protein	99.91
d1rkua_		206	Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta	99.76
d1j97a_		210	Phosphoserine phosphatase {Archaeon Methanococcus	99.63
d1k1ea_		177	Probable phosphatase YrbI {Haemophilus influenzae,	99.61
d2c4na1		250	NagD {Escherichia coli [TaxId: 562]}	99.18
d1yv9a1		253	Putative hydrolase EF1188 {Enterococcus faecalis [	99.07
d1vjra_		261	Hypothetical protein TM1742 {Thermotoga maritima [	99.05
d2feaa1		226	2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate	99.01
d2ah5a1		210	predicted phosphatase SP0104 {Streptococcus pneumo	98.94
d1u7pa_		164	Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu	98.9
d1nnla_		217	Phosphoserine phosphatase {Human (Homo sapiens) [T	98.89
d2hdoa1		207	Phosphoglycolate phosphatase {Lactobacillus planta	98.74
d1wvia_		253	Putative phosphatase SMU.1415c {Streptococcus muta	98.72
d2fpwa1		161	Histidine biosynthesis bifunctional protein HisB,	98.67
d1te2a_		218	Phosphatase YniC {Escherichia coli [TaxId: 562]}	98.67
d2hsza1		224	Phosphoglycolate phosphatase Gph {Haemophilus somn	98.6
d2b8ea1		135	Cation-transporting ATPase {Archaeon Archaeoglobus	98.57
d2gmwa1		182	D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc	98.55
d2hcfa1		228	Hypothetical protein CT1708 {Chlorobium tepidum [T	98.47
d1wpga2		168	Calcium ATPase, catalytic domain P {Rabbit (Orycto	98.46
d2o2xa1		209	Hypothetical protein Mll2559 {Mesorhizobium loti [	98.43
d2fdra1		222	Hypothetical protein Atu0790 {Agrobacterium tumefa	98.42
d2go7a1		204	Hypothetical protein SP2064 {Streptococcus pneumon	98.41
d1x42a1		230	Hypothetical protein PH0459 {Archaeon Pyrococcus h	98.37
d1swva_		257	Phosphonoacetaldehyde hydrolase {Bacillus cereus [	98.36
d1o08a_		221	beta-Phosphoglucomutase {Lactococcus lactis [TaxId	98.36
d2fi1a1		187	Putative hydrolase SP0805 {Streptococcus pneumonia	98.33
d1ltqa1		149	Polynucleotide kinase, phosphatase domain {Bacteri	97.9
d2gfha1		247	N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m	97.81
d3bb9a1		121	Uncharacterized protein Sfri1973 {Shewanella frigi	97.65
d3cu3a1		162	Uncharacterized protein NpunR1993 {Nostoc punctifo	97.58
d2r4ia1		122	Uncharacterized protein CHU142 {Cytophaga hutchins	97.57
d2owpa1		128	Hypothetical protein BxeB1374 {Burkholderia xenovo	97.55
d3b7ca1		121	Uncharacterized protein SO0125 {Shewanella oneiden	97.48
d1xpja_		124	Hypothetical protein VC0232 {Vibrio cholerae [TaxI	97.39
d2obba1		122	Hypothetical protein BT0820 {Bacteroides thetaiota	97.37
d2bdua1		291	Cytosolic 5'-nucleotidase III {Mouse (Mus musculus	97.29
d1cr6a1		222	Epoxide hydrolase, N-terminal domain {Mouse (Mus m	97.03
d3cnxa1		153	Uncharacterized protein SAV4671 {Streptomyces aver	97.02
d2rcda1		127	Uncharacterized protein ECA3500 {Pectobacterium at	97.0
d2b0ca1		197	Putative phosphatase YihX {Escherichia coli [TaxId	96.99
d1zs9a1		253	E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]}	96.94
d2f86b1		129	Association domain of calcium/calmodulin-dependent	96.84
d3d9ra1		132	Uncharacterized protein ECA1476 {Pectobacterium at	96.8
d1zd3a1		225	Epoxide hydrolase, N-terminal domain {Human (Homo	96.68
d2ux0a1		135	Association domain of calcium/calmodulin-dependent	96.51
d2g80a1		225	Protein UTR4 {Baker's yeast (Saccharomyces cerevis	95.8
d1zrna_		220	L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s	95.3
d1qq5a_		245	L-2-Haloacid dehalogenase, HAD {Xanthobacter autot	94.87
d2gxfa1		128	Hypothetical protein YybH {Bacillus subtilis [TaxI	94.85
d2b82a1		209	Class B acid phosphatase, AphA {Escherichia coli [	94.84
d1yj5a1		195	5' polynucleotide kinase-3' phosphatase, middle do	94.81
d1qyia_		380	Hypothetical protein MW1667 (SA1546) {Staphylococc	94.71
d1ohpa1		125	Delta-5-3-ketosteroid isomerase, steroid delta-iso	93.29
d1nwwa_		145	Limonene-1,2-epoxide hydrolase {Rhodococcus erythr	93.19
d3dmca1		133	Uncharacterized protein Ava2261 {Anabaena variabil	91.37
d3dxoa1		117	Uncharacterized protein Atu0744 {Agrobacterium tum	90.57
d2gexa1		138	Nogalamycin biosynthesis protein SnoL {Streptomyce	90.42
d1zrna_		220	L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s	90.27
d1qq5a_		245	L-2-Haloacid dehalogenase, HAD {Xanthobacter autot	89.85
d1oh0a_		125	Delta-5-3-ketosteroid isomerase, steroid delta-iso	89.55
d2g80a1		225	Protein UTR4 {Baker's yeast (Saccharomyces cerevis	89.12
d1zs9a1		253	E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]}	89.0
d1cr6a1		222	Epoxide hydrolase, N-terminal domain {Mouse (Mus m	88.13
d1ltqa1		149	Polynucleotide kinase, phosphatase domain {Bacteri	87.47
d1zd3a1		225	Epoxide hydrolase, N-terminal domain {Human (Homo	87.38
d3ebta1		131	Uncharacterized protein BPSS0132 {Burkholderia pse	86.12
d2b0ca1		197	Putative phosphatase YihX {Escherichia coli [TaxId	85.93
d3blza1		124	Uncharacterized protein Sbal0622 {Shewanella balti	84.67
d2k54a1		123	Uncharacterized protein Atu0742 {Agrobacterium tum	84.48
d1y8aa1		308	Hypothetical protein AF1437 {Archaeon Archaeoglobu	83.72
d1ta0a_		181	Carboxy-terminal domain RNA polymerase II polypept	83.06
d1tuha_		131	Hypothetical protein egc068 from a soil-derived mo	80.28

>d1tp6a_ d.17.4.12 (A:) Hypothetical protein PA1314 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Cystatin-like
superfamily: NTF2-like
family: PA1314-like
domain: Hypothetical protein PA1314
species: Pseudomonas aeruginosa [TaxId: 287]

Probab=100.00  E-value=1.8e-44  Score=299.40  Aligned_cols=122  Identities=16%  Similarity=0.217  Sum_probs=117.5

Q ss_pred             hHHHHHHHHHHHHhcccccCCHHHHHHHHhccCCCceEeCCCCcccCHHHHHHHHHhhcCCCCCceEEEEEeeeEEeeee
Q 014649          285 HEVVKLYLFYERWRRAEIDNSEIYLSSLKANCCPSGFCVPPSGGEISLAEAINQFRKCYGDKQGKQFRVWVDRVLSTEIG  364 (421)
Q Consensus       285 ~evv~~~~~~e~w~~~~~~~~~~~~~~l~~~~~p~~~~v~~~G~~~~~~~~~~~~~~~~g~~~g~~~~i~vd~~~~~~~~  364 (421)
                      +||+++|++||+||+|+++  ++++++|+++|+|+||||+|+|.++|++++++.|+++||+|||  |+||||++++++.+
T Consensus         5 ~EV~~~H~~ie~W~~ge~~--~~~l~~L~a~f~p~FsMV~~~G~~l~~~~~~~~f~~~~G~rpG--l~I~id~~~~~~~~   80 (126)
T d1tp6a_           5 REIHHAHVAIRDWLAGDSR--ADALDALMARFAEDFSMVTPHGVVLDKTALGELFRSKGGTRPG--LRIEIDGESLLASG   80 (126)
T ss_dssp             HHHHHHHHHHHHHHHTCCC--TTHHHHHHTTEEEEEEEECTTSCEEEHHHHHHHHHHHTTCSTT--CEEEEEEEEEEEEE
T ss_pred             HHHHHHHHHHHHHhcCCCC--HHHHHHHHHhcCCCcEEECCCCeEcCHHHHHHHHHHhcCCCCc--cEEEEEEEEEEEEe
Confidence            7999999999999999654  6789999999999999999999999999999999999999999  99999999999999


Q ss_pred             CCeEEEEEeeeEEeCcceeeEEEEEEEEEeCCCCeeEEEeeeeccc
Q 014649          365 PGTWLVKFHKWELSGEERACSIVSIIVRIKDASDHTYMHVHETWLE  410 (421)
Q Consensus       365 ~~~~~v~~~~~~~~~~~~~~~~~t~~~~~~~~~~~~w~h~het~~~  410 (421)
                      +++|+|+|+|||+.++++++|+|||||+.+++++++|+|||||||.
T Consensus        81 ~~~~vv~Y~E~q~~~~~~~~R~STavl~~~~~g~~~W~hLHET~l~  126 (126)
T d1tp6a_          81 VDGATLAYREIQSDAAGRSERLSTVVLHRDDEGRLYWRHLQETFCG  126 (126)
T ss_dssp             TTEEEEEEEEEEEETTEEEEEEEEEEEEECTTCCEEEEEEEEEECC
T ss_pred             CCeEEEEEEEEEecCCcceEEEEEEEEEEcCCCCeEEeehhhhhcC
Confidence            9999999999999988999999999999988889999999999983

PyMOL of d1tp6a_

>d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]}	Back information, alignment and structure

>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]}	Back information, alignment and structure

>d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]}	Back information, alignment and structure

>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]}	Back information, alignment and structure

>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]}	Back information, alignment and structure

>d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]}	Back information, alignment and structure

>d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]}	Back information, alignment and structure

>d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]}	Back information, alignment and structure

>d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}	Back information, alignment and structure

>d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]}	Back information, alignment and structure

>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]}	Back information, alignment and structure

>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]}	Back information, alignment and structure

>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d3bb9a1 d.17.4.16 (A:27-147) Uncharacterized protein Sfri1973 {Shewanella frigidimarina [TaxId: 56812]}	Back information, alignment and structure

>d3cu3a1 d.17.4.28 (A:9-170) Uncharacterized protein NpunR1993 {Nostoc punctiforme [TaxId: 272131]}	Back information, alignment and structure

>d2r4ia1 d.17.4.15 (A:1-122) Uncharacterized protein CHU142 {Cytophaga hutchinsonii [TaxId: 985]}	Back information, alignment and structure

>d2owpa1 d.17.4.18 (A:1-128) Hypothetical protein BxeB1374 {Burkholderia xenovorans [TaxId: 36873]}	Back information, alignment and structure

>d3b7ca1 d.17.4.16 (A:1-121) Uncharacterized protein SO0125 {Shewanella oneidensis [TaxId: 70863]}	Back information, alignment and structure

>d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]}	Back information, alignment and structure

>d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]}	Back information, alignment and structure

>d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d3cnxa1 d.17.4.17 (A:5-157) Uncharacterized protein SAV4671 {Streptomyces avermitilis [TaxId: 33903]}	Back information, alignment and structure

>d2rcda1 d.17.4.18 (A:1-127) Uncharacterized protein ECA3500 {Pectobacterium atrosepticum [TaxId: 29471]}	Back information, alignment and structure

>d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2f86b1 d.17.4.7 (B:343-471) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d3d9ra1 d.17.4.27 (A:3-134) Uncharacterized protein ECA1476 {Pectobacterium atrosepticum [TaxId: 29471]}	Back information, alignment and structure

>d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ux0a1 d.17.4.7 (A:387-521) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]}	Back information, alignment and structure

>d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]}	Back information, alignment and structure

>d2gxfa1 d.17.4.22 (A:1-128) Hypothetical protein YybH {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1ohpa1 d.17.4.3 (A:1-125) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId: 285]}	Back information, alignment and structure

>d1nwwa_ d.17.4.8 (A:) Limonene-1,2-epoxide hydrolase {Rhodococcus erythropolis [TaxId: 1833]}	Back information, alignment and structure

>d3dmca1 d.17.4.10 (A:1-133) Uncharacterized protein Ava2261 {Anabaena variabilis [TaxId: 1172]}	Back information, alignment and structure

>d3dxoa1 d.17.4.19 (A:1-117) Uncharacterized protein Atu0744 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d2gexa1 d.17.4.9 (A:2-139) Nogalamycin biosynthesis protein SnoL {Streptomyces nogalater [TaxId: 38314]}	Back information, alignment and structure

>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]}	Back information, alignment and structure

>d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]}	Back information, alignment and structure

>d1oh0a_ d.17.4.3 (A:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]}	Back information, alignment and structure

>d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3ebta1 d.17.4.9 (A:1-131) Uncharacterized protein BPSS0132 {Burkholderia pseudomallei [TaxId: 28450]}	Back information, alignment and structure

>d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d3blza1 d.17.4.14 (A:3-126) Uncharacterized protein Sbal0622 {Shewanella baltica [TaxId: 62322]}	Back information, alignment and structure

>d2k54a1 d.17.4.29 (A:1-123) Uncharacterized protein Atu0742 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1y8aa1 c.108.1.24 (A:1-308) Hypothetical protein AF1437 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1tuha_ d.17.4.11 (A:) Hypothetical protein egc068 from a soil-derived mobile gene cassette {uncultured organism [TaxId: 155900]}	Back information, alignment and structure