Citrus Sinensis ID: 014663

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420

MDKKFFFSCFGKNKKKMEMADSIAKKWRSLSGQNNWEGLLDPLDIDLRRYMIHYGEIAQAAYDTFNTEKASKYAGDSIYAKKDFFSKVGLDKGNPYKYNVTKFFYATSQIHVPEAFIIVPLSREAWSKESNWMGYVAVATDEGKAVLGRRDIVIAWRGSLQTLEWVNDLEFNFVSAEKIFGGDRTDDPKVHQGWYSIYTSDDQRSPFNKTSARDQVIHEIRRLVDQYKNEEISITVTGHSLGAALATLNAVDIAANGFNKPGGQPNKACPVTAIIFASPRVGDSTFKKVLSGYQDLRVLRIRNELDVVPKYPLIGYEDVGKELTIDTTNSKYLKNGAANFSGWHNLEVYLHGVAGTQGRKGGFQLEVNRDISLVNKTMDSLKDQYLVPVSWRILKNKGMVQQADGSWKLMDHEKDDDIDP

ccccccHHccccccccccccHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHccccccccccccccEEEECccccccccccccccccccccccccccEEEEEEccccccccccccEEEEEcccccHHHHHHccccccEEccccccccccccccccccHHHHHcccccccccccHHHHHHHHHHHHHHHHHccccccEEEEEEccHHHHHHHHHHHHHHHcccccccccccccccEEEEEccccccccHHHHHHHHccccccEEEEEEcccccccccccccccccEEEEEcccccccccccccccccccccccEEEcccccccccccccccccccHHHHHHHHHccccccccccccEEEcccccEEcccccEECccccccccccc

****FFFSCFGK*********SIAKKWRSLSGQNNWEGLLDPLDIDLRRYMIHYGEIAQAAYDTFNTEKASKYAGDSIYAKKDFFSKVGLDKGNPYKYNVTKFFYATSQIHVPEAFIIVPLSREAWSKESNWMGYVAVATDEGKAVLGRRDIVIAWRGSLQTLEWVNDLEFNFVSAEKIFGGDRTDDPKVHQGWYSIYTSDDQRSPFNKTSARDQVIHEIRRLVDQYKNEEISITVTGHSLGAALATLNAVDIAANGFNKPGGQPNKACPVTAIIFASPRVGDSTFKKVLSGYQDLRVLRIRNELDVVPKYPLIGYEDVGKELTIDTTNSKYLKNGAANFSGWHNLEVYLHGVAGTQGRKGGFQLEVNRDISLVNKTMDSLKDQYLVPVSWRILKNKGMVQQADGSWK************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Phospholipase A1-IIgamma	Acylhydrolase that catalyzes the hydrolysis of 1,3-diacylglycerol (1,3-DAG) and 1-monoacylglycerol (1-MAG) at the sn-1 position. High activity toward 1,3-DAG and 1-MAG, but low activity toward 1,2-diacylglycerol (1,2-DAG) and 1-lysophosphatidylcholine (1-LPC), and no activity toward phosphatidylcholine (PC), monogalactosyldiacylglycerol (MGDG), digalactosyldiacylglycerol (DGDG), triacylglycerol (TAG) and 2-monoacylglycerol (2-MAG). May be involved in the negative regulation of seedling establishment by inhibiting the breakdown, beta-oxidation and mobilization of seed storage oils.	probable	O49523
Phospholipase A1-II 1	Acylhydrolase that catalyzes the hydrolysis of phospholipids at the sn-1 position.	probable	A2ZW16
Phospholipase A1-II 4	Acylhydrolase that catalyzes the hydrolysis of phospholipids at the sn-1 position.	probable	B9EYD3

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YIJ, chain A
Confidence level:very confident
Coverage over the Query: 23-419
View the alignment between query and template
View the model in PyMOL