BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 014728
         (419 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3RHF|A Chain A, Crystal Structure Of Polyphosphate Kinase 2 From
           Arthrobacter Aurescens Tc1
 pdb|3RHF|B Chain B, Crystal Structure Of Polyphosphate Kinase 2 From
           Arthrobacter Aurescens Tc1
 pdb|3RHF|C Chain C, Crystal Structure Of Polyphosphate Kinase 2 From
           Arthrobacter Aurescens Tc1
 pdb|3RHF|D Chain D, Crystal Structure Of Polyphosphate Kinase 2 From
           Arthrobacter Aurescens Tc1
          Length = 289

 Score = 28.5 bits (62), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 1/53 (1%)

Query: 130 RVDNQISEEKLKRKKKIHRNDIGSKQTEEGTYVMKIKLCCDSCNQKLRKIMKI 182
           RV       +L+R+     ND  S+ TE+GT ++K+ L      QK R I ++
Sbjct: 150 RVHGWADAAELERRYAA-INDFESRLTEQGTTIVKVXLNISKDEQKKRLIARL 201


>pdb|1G63|A Chain A, Peptidyl-Cysteine Decarboxylase Epid
 pdb|1G63|B Chain B, Peptidyl-Cysteine Decarboxylase Epid
 pdb|1G63|C Chain C, Peptidyl-Cysteine Decarboxylase Epid
 pdb|1G63|D Chain D, Peptidyl-Cysteine Decarboxylase Epid
 pdb|1G63|E Chain E, Peptidyl-Cysteine Decarboxylase Epid
 pdb|1G63|F Chain F, Peptidyl-Cysteine Decarboxylase Epid
 pdb|1G63|G Chain G, Peptidyl-Cysteine Decarboxylase Epid
 pdb|1G63|H Chain H, Peptidyl-Cysteine Decarboxylase Epid
 pdb|1G63|I Chain I, Peptidyl-Cysteine Decarboxylase Epid
 pdb|1G63|J Chain J, Peptidyl-Cysteine Decarboxylase Epid
 pdb|1G63|K Chain K, Peptidyl-Cysteine Decarboxylase Epid
 pdb|1G63|L Chain L, Peptidyl-Cysteine Decarboxylase Epid
          Length = 181

 Score = 28.5 bits (62), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 33/66 (50%), Gaps = 11/66 (16%)

Query: 3   LLCKGVYSEILDSVLNRVVAEEALE--LDSPSDSVTNSNSAQVINKAISNKVADQLVTFI 60
           L C  +Y EI D +LN +   E  E  L  P+       SA  INK I+N + D L+T +
Sbjct: 51  LFCDNLYDEIKDPLLNHINIVENHEYILVLPA-------SANTINK-IANGICDNLLTTV 102

Query: 61  LIVHGY 66
            +  GY
Sbjct: 103 CLT-GY 107


>pdb|1G5Q|A Chain A, Epid H67n Complexed With Substrate Peptide Dsytc
 pdb|1G5Q|D Chain D, Epid H67n Complexed With Substrate Peptide Dsytc
 pdb|1G5Q|G Chain G, Epid H67n Complexed With Substrate Peptide Dsytc
 pdb|1G5Q|L Chain L, Epid H67n Complexed With Substrate Peptide Dsytc
          Length = 181

 Score = 28.1 bits (61), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 33/66 (50%), Gaps = 11/66 (16%)

Query: 3   LLCKGVYSEILDSVLNRVVAEEALE--LDSPSDSVTNSNSAQVINKAISNKVADQLVTFI 60
           L C  +Y EI D +LN +   E  E  L  P+       SA  INK I+N + D L+T +
Sbjct: 51  LFCDNLYDEIKDPLLNNINIVENHEYILVLPA-------SANTINK-IANGICDNLLTTV 102

Query: 61  LIVHGY 66
            +  GY
Sbjct: 103 CLT-GY 107


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.311    0.131    0.362 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 12,271,728
Number of Sequences: 62578
Number of extensions: 540796
Number of successful extensions: 1220
Number of sequences better than 100.0: 31
Number of HSP's better than 100.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 21
Number of HSP's that attempted gapping in prelim test: 1205
Number of HSP's gapped (non-prelim): 37
length of query: 419
length of database: 14,973,337
effective HSP length: 101
effective length of query: 318
effective length of database: 8,652,959
effective search space: 2751640962
effective search space used: 2751640962
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 53 (25.0 bits)