Citrus Sinensis ID: 014755


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------42
MEFTEAYKQTGPSCFSPNARYIAVAVDYRLVVRDAHSFKVVQLFSCLDKISYIEWALDSEYILCGLYKRLMIQAWSLTQPEWTCKIDEGLAGIAYARWSPDSRHILTTSDFQLRLTVWSLLNTACVHVQSPKHASKGVAFTQDGKFAAICTRRDCKDYINLLSCHTWEIMGVFAVDTLDLADIEWSPDDSAIVIWDSPLEYKVLIYSPDGRCLLKYQAYESGLGVKSISWSPCGQFLAVGSYDQTLRVLNHLTWKTFAEFMHLSTVRGPCFPAVFKEVDEPLQLDMSELCLNDDFIQGNSDATNGHIKVRYEVMEIPISLPFQKPPTDKPNPKQGIGLMSWSSDSQYICTRNDSMPTTLWIWDICRQEPAAILVQKDPIRAATWDPTCTRLVLCTGSSHLYMWTPSGAYCVSNPLPQFN
cccccccccCCcEEEcccccEEEEEEccEEEEEEcccccEEEEEEccccEEEEEEcccccEEEEEEccccEEEEEEcccccEEEEECcccccEEEEEEcccccEEEEEEccccEEEEEEcccccEEEEccccccEEEEEEcccccEEEEEEcccccccEEEEEccccEEEEEECcccccEEEEEEcccccEEEEEcccccCEEEEECccccEEEEEEcccccccEEEEEEcccccEEEEECccccEEEEEcccccEEEEEEccccEEccEEccccCECccccccccccccccccccccccccccccEEEEEEEEECcccccccccccccccccccEEEEEEcccccEEEECccccccEEEEEEcccccEEEEEcccccEEEEEEcccccEEEEECccccEEEEccccccEEEccccccc
*EF*EAYKQTGPSCFSPNARYIAVAVDYRLVVRDAHSFKVVQLFSCLDKISYIEWALDSEYILCGLYKRLMIQAWSLTQPEWTCKIDEGLAGIAYARWSPDSRHILTTSDFQLRLTVWSLLNTACVHVQSPKHASKGVAFTQDGKFAAICTRRDCKDYINLLSCHTWEIMGVFAVDTLDLADIEWSPDDSAIVIWDSPLEYKVLIYSPDGRCLLKYQAYESGLGVKSISWSPCGQFLAVGSYDQTLRVLNHLTWKTFAEFMHLSTVRGPCFPAVFKEVDEPLQLDMSELCLNDDFIQGNSDATNGHIKVRYEVMEIPISLPFQKPPTDKPNPKQGIGLMSWSSDSQYICTRNDSMPTTLWIWDICRQEPAAILVQKDPIRAATWDPTCTRLVLCTGSSHLYMWTPSGAYCVSNPL****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEFTEAYKQTGPSCFSPNARYIAVAVDYRLVVRDAHSFKVVQLFSCLDKISYIEWALDSEYILCGLYKRLMIQAWSLTQPEWTCKIDEGLAGIAYARWSPDSRHILTTSDFQLRLTVWSLLNTACVHVQSPKHASKGVAFTQDGKFAAICTRRDCKDYINLLSCHTWEIMGVFAVDTLDLADIEWSPDDSAIVIWDSPLEYKVLIYSPDGRCLLKYQAYESGLGVKSISWSPCGQFLAVGSYDQTLRVLNHLTWKTFAEFMHLSTVRGPCFPAVFKEVDEPLQLDMSELCLNDDFIQGNSDATNGHIKVRYEVMEIPISLPFQKPPTDKPNPKQGIGLMSWSSDSQYICTRNDSMPTTLWIWDICRQEPAAILVQKDPIRAATWDPTCTRLVLCTGSSHLYMWTPSGAYCVSNPLPQFN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
WD repeat-containing protein WRAP73 probableQ9JM98
WD repeat-containing protein WRAP73 probableQ9P2S5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YMU, chain A
Confidence level:very confident
Coverage over the Query: 13-409
View the alignment between query and template
View the model in PyMOL
Template: 2OAJ, chain A
Confidence level:confident
Coverage over the Query: 6-411
View the alignment between query and template
View the model in PyMOL