Citrus Sinensis ID: 014757

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------42
MRLLSSLYLPLKQPFIRKRFPCFFHSLSLSSLFMAPAFEDNNSETLPSSFSSGSDDGVLHKSKVTVVGSGNWGSVASKLIASNTLRLSSFHDEVRMWVFEETLPSGEKLTDVINRTNENVKYLPGIKLGKNVVADPDLENAVKDANMLVFVTPHQFMEGICKRLVGKVNGDVEAISLIKGMEVKREGPCMISTLISEQLGVSCCVLMGANIANEIAVEKFSEATVGYRDNREIAEKWVQLFSTPYFMVTAVQDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRIGLREMRAFSKLLFSSVKDSTFFESCGVADLITTCLGGRNRKVAEAFAKNEGKRSFDDLEAEMLQGQKLQGVSTAREVYEVLSHRGWLELFPLFATVHEICVGHLPPSAIVEYSERKPRLSLLEGSTQYY
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccHHHHHHHHHHHccccccccccEEEEEEEcccccccHHHHHHHHHccccccccccccccccEEEcccHHHHHccccEEEEEcccHHHHHHHHHHHcccccccEEEEEEEccEEcccccccHHHHHHHHHcccEEEEcccccHHHHHcccccEEEEEEcccHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEcccccccHHHHHHHHcccccccHHHHHHHHHcccEEccHHHHHHHHHHHHHccccccccHHHHHHHHHcccccHHHHHHHHHccccccccccccccc
cccHHcccccccccHHHccccccccccccccccccHHHHHccccccccccccccccccccccEEEEEEcccHHHHHHHHHHHHHccccHccccEEEEEEEEEcccccccEEHEccccccccccccccccccEEEcccHHHHHccccEEEEEccHHHHHHHHHHHHcccccccEEEEEEccccccccccHHHHHHHHHHccccEEEEccccHHHHHHHccccEEEEEccccHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHccHcHEEEEccccccHHHHHHHHcccccccHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHcccHHHHHHHHHHccccHHHHHHHHHccccHHHHHHHcccc
mrllsslylplkqpfirkrfpcffhslslsslfmapafednnsetlpssfssgsddgvlhkSKVTVVGSGNWGSVASKLIAsntlrlssfhDEVRMWVFeetlpsgeklTDVINRtnenvkylpgiklgknvvadpdlenavkdANMLVFVTPHQFMEGICKRLVGKVNGDVEAISLIKgmevkregpcmISTLISEQLGVSCCVLMGANIANEIAVEKfseatvgyrdNREIAEKWVQLFSTPYFMVTAVQDVEGVELCGTLKNVVAIAAGFvdglemgnnTKAAIMRIGLREMRAFSKLLFSsvkdstffescgvADLITTCLGGRNRKVAEAFAknegkrsfDDLEAEMLQGQKLQGVSTAREVYEVLSHRGWLELFPLFATVHEIcvghlppsaiveyserkprlsllegstqyy
MRLLSSLYLPLKQPFIRKRFPCFFHSLSLSSLFMAPAFEDNNSETLPSSFSSGSDDGVLHKSKVTvvgsgnwgsVASKLIASNTLRLSSFHDEVRMWVFEetlpsgekltdvINRTNEnvkylpgiklgKNVVADPDLENAVKDANMLVFVTPHQFMEGICKRLVGKVNGDVEAISLikgmevkreGPCMISTLISEQLGVSCCVLMGANIANEIAVEKFSEATVGYRDNREIAEKWVQLFSTPYFMVTAVQDVEGVELCGTLKNVVAIAAGfvdglemgnNTKAAIMRIGLREMRAFSKLLFSSVKDSTFFESCGVADLIttclggrnRKVAEAFAKNEGKRSFDDLEAEMLqgqklqgvSTAREVYEVLSHRGWLELFPLFATVHEICVGHLPpsaiveyserkprlsllegstqyy
MRLLSSLYLPLKQPFIRKRFPCFFHslslsslFMAPAFEDNNSETLPSSFSSGSDDGVLHKSKVTVVGSGNWGSVASKLIASNTLRLSSFHDEVRMWVFEETLPSGEKLTDVINRTNENVKYLPGIKLGKNVVADPDLENAVKDANMLVFVTPHQFMEGICKRLVGKVNGDVEAISLIKGMEVKREGPCMISTLISEQLGVSCCVLMGANIANEIAVEKFSEATVGYRDNREIAEKWVQLFSTPYFMVTAVQDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRIGLREMRAFSKLLFSSVKDSTFFESCGVADLITTCLGGRNRKVAEAFAKNEGKRSFDDLEAEMLQGQKLQGVSTAREVYEVLSHRGWLELFPLFATVHEICVGHLPPSAIVEYSERKPRLSLLEGSTQYY
*****SLYLPLKQPFIRKRFPCFFHSLSLSSLFMAP************************KSKVTVVGSGNWGSVASKLIASNTLRLSSFHDEVRMWVFEETLPSGEKLTDVINRTNENVKYLPGIKLGKNVVADPDLENAVKDANMLVFVTPHQFMEGICKRLVGKVNGDVEAISLIKGMEVKREGPCMISTLISEQLGVSCCVLMGANIANEIAVEKFSEATVGYRDNREIAEKWVQLFSTPYFMVTAVQDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRIGLREMRAFSKLLFSSVKDSTFFESCGVADLITTCLGGRNRKVAEAF*********************LQGVSTAREVYEVLSHRGWLELFPLFATVHEICVGHLPPSAIVEY*****************
****SS*YLPL***************LS***********************************VTVVGSGNWGSVASKLIASNTLRLSSFHDEVRMWVFEETLPSGEKLTDVINRTNENVKYLPGIKLGKNVVADPDLENAVKDANMLVFVTPHQFMEGICKRLVGKVNGDVEAISLIKGMEVKREGPCMISTLISEQLGVSCCVLMGANIANEIAVEKFSEATVGYRDNREIAEKWVQLFSTPYFMVTAVQDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRIGLREMRAFSKLLFSSVKDSTFFESCGVADLITTCLGGRNRKVAEAFAKNEGKRSFDDLEAEMLQGQKLQGVSTAREVYEVLSHRGWLELFPLFATVHEICVGHLPPSAIVE******************
MRLLSSLYLPLKQPFIRKRFPCFFHSLSLSSLFMAPAFEDNNSETLPSSFSSGSDDGVLHKSKVTVVGSGNWGSVASKLIASNTLRLSSFHDEVRMWVFEETLPSGEKLTDVINRTNENVKYLPGIKLGKNVVADPDLENAVKDANMLVFVTPHQFMEGICKRLVGKVNGDVEAISLIKGMEVKREGPCMISTLISEQLGVSCCVLMGANIANEIAVEKFSEATVGYRDNREIAEKWVQLFSTPYFMVTAVQDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRIGLREMRAFSKLLFSSVKDSTFFESCGVADLITTCLGGRNRKVAEAFAKNEGKRSFDDLEAEMLQGQKLQGVSTAREVYEVLSHRGWLELFPLFATVHEICVGHLPPSAIVEYSERKPRLSLLEGSTQYY
*RLLSSLYLPLKQPFIRKRFPCFFHSLSLSSLFM*************************HKSKVTVVGSGNWGSVASKLIASNTLRLSSFHDEVRMWVFEETLPSGEKLTDVINRTNENVKYLPGIKLGKNVVADPDLENAVKDANMLVFVTPHQFMEGICKRLVGKVNGDVEAISLIKGMEVKREGPCMISTLISEQLGVSCCVLMGANIANEIAVEKFSEATVGYRDNREIAEKWVQLFSTPYFMVTAVQDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRIGLREMRAFSKLLFSSVKDSTFFESCGVADLITTCLGGRNRKVAEAFAKNEGKRSFDDLEAEMLQGQKLQGVSTAREVYEVLSHRGWLELFPLFATVHEICVGHLPPSAIVEYSERKPRLSLLEG****Y
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRLLSSLYLPLKQPFIRKRFPCFFHSLSLSSLFMAPAFEDNNSETLPSSFSSGSDDGVLHKSKVTVVGSGNWGSVASKLIASNTLRLSSFHDEVRMWVFEETLPSGEKLTDVINRTNENVKYLPGIKLGKNVVADPDLENAVKDANMLVFVTPHQFMEGICKRLVGKVNGDVEAISLIKGMEVKREGPCMISTLISEQLGVSCCVLMGANIANEIAVEKFSEATVGYRDNREIAEKWVQLFSTPYFMVTAVQDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRIGLREMRAFSKLLFSSVKDSTFFESCGVADLITTCLGGRNRKVAEAFAKNEGKRSFDDLEAEMLQGQKLQGVSTAREVYEVLSHRGWLELFPLFATVHEICVGHLPPSAIVEYSERKPRLSLLEGSTQYY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query419 2.2.26 [Sep-21-2011]
P52425372 Glycerol-3-phosphate dehy N/A no 0.866 0.975 0.852 0.0
Q9SCX9400 Glycerol-3-phosphate dehy yes no 0.871 0.912 0.820 1e-180
Q5EA88349 Glycerol-3-phosphate dehy yes no 0.816 0.979 0.524 2e-98
P21695349 Glycerol-3-phosphate dehy yes no 0.816 0.979 0.521 1e-97
Q5R5V3351 Glycerol-3-phosphate dehy yes no 0.813 0.971 0.520 6e-97
Q8N335351 Glycerol-3-phosphate dehy no no 0.813 0.971 0.520 7e-97
Q6P824352 Glycerol-3-phosphate dehy yes no 0.816 0.971 0.518 9e-97
P13707349 Glycerol-3-phosphate dehy yes no 0.813 0.977 0.526 1e-96
Q5RCE0349 Glycerol-3-phosphate dehy no no 0.816 0.979 0.518 1e-96
Q3ULJ0351 Glycerol-3-phosphate dehy no no 0.813 0.971 0.517 2e-96
>sp|P52425|GPDA_CUPLA Glycerol-3-phosphate dehydrogenase [NAD(+)] OS=Cuphea lanceolata GN=GPDH PE=2 SV=1 Back     alignment and function desciption
 Score =  643 bits (1658), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/366 (85%), Positives = 339/366 (92%), Gaps = 3/366 (0%)

Query: 45  TLPSSFSSGSDDGVLHKSKVTVVGSGNWGSVASKLIASNTLRLSSFHDEVRMWVFEETLP 104
           T  +  SSG D     +S+VTVVGSGNWGSVA+KLIA+NTL+L SFHDEVRMWVFEETLP
Sbjct: 9   THQNQHSSGYDG---PRSRVTVVGSGNWGSVAAKLIATNTLKLPSFHDEVRMWVFEETLP 65

Query: 105 SGEKLTDVINRTNENVKYLPGIKLGKNVVADPDLENAVKDANMLVFVTPHQFMEGICKRL 164
           SGEKLTDVIN+TNENVKYLPGIKLG+NVVADPDLENAVKDANMLVFVTPHQFMEGICKRL
Sbjct: 66  SGEKLTDVINQTNENVKYLPGIKLGRNVVADPDLENAVKDANMLVFVTPHQFMEGICKRL 125

Query: 165 VGKVNGDVEAISLIKGMEVKREGPCMISTLISEQLGVSCCVLMGANIANEIAVEKFSEAT 224
            GK+    +A+SLIKGMEVK EGPCMIS+LIS+ LG++CCVLMGANIANEIAVEKFSEAT
Sbjct: 126 EGKIQEGAQALSLIKGMEVKMEGPCMISSLISDLLGINCCVLMGANIANEIAVEKFSEAT 185

Query: 225 VGYRDNREIAEKWVQLFSTPYFMVTAVQDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTK 284
           VG+R+NR+IAEKWVQLFSTPYFMV+AV+DVEGVELCGTLKN+VAIAAGFVDGLEMGNNTK
Sbjct: 186 VGFRENRDIAEKWVQLFSTPYFMVSAVEDVEGVELCGTLKNIVAIAAGFVDGLEMGNNTK 245

Query: 285 AAIMRIGLREMRAFSKLLFSSVKDSTFFESCGVADLITTCLGGRNRKVAEAFAKNEGKRS 344
           AAIMRIGLREM+AFSKLLF SVKD+TFFESCGVADLITTCLGGRNRKVAEAFAKN GKRS
Sbjct: 246 AAIMRIGLREMKAFSKLLFPSVKDTTFFESCGVADLITTCLGGRNRKVAEAFAKNGGKRS 305

Query: 345 FDDLEAEMLQGQKLQGVSTAREVYEVLSHRGWLELFPLFATVHEICVGHLPPSAIVEYSE 404
           FDDLEAEML+GQKLQGVSTA+EVYEVL HRGWLELFPLF+TVHEI  G LPPSAIVEYSE
Sbjct: 306 FDDLEAEMLRGQKLQGVSTAKEVYEVLGHRGWLELFPLFSTVHEISTGRLPPSAIVEYSE 365

Query: 405 RKPRLS 410
           +K   S
Sbjct: 366 QKTIFS 371

Cuphea lanceolata (taxid: 3930)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 8
>sp|Q9SCX9|GPDA1_ARATH Glycerol-3-phosphate dehydrogenase [NAD(+)] 1, chloroplastic OS=Arabidopsis thaliana GN=DHAPRD PE=1 SV=1 Back     alignment and function description
>sp|Q5EA88|GPDA_BOVIN Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic OS=Bos taurus GN=GPD1 PE=2 SV=3 Back     alignment and function description
>sp|P21695|GPDA_HUMAN Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic OS=Homo sapiens GN=GPD1 PE=1 SV=4 Back     alignment and function description
>sp|Q5R5V3|GPD1L_PONAB Glycerol-3-phosphate dehydrogenase 1-like protein OS=Pongo abelii GN=GPD1L PE=2 SV=1 Back     alignment and function description
>sp|Q8N335|GPD1L_HUMAN Glycerol-3-phosphate dehydrogenase 1-like protein OS=Homo sapiens GN=GPD1L PE=1 SV=1 Back     alignment and function description
>sp|Q6P824|GPD1L_XENTR Glycerol-3-phosphate dehydrogenase 1-like protein OS=Xenopus tropicalis GN=gpd1l PE=2 SV=1 Back     alignment and function description
>sp|P13707|GPDA_MOUSE Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic OS=Mus musculus GN=Gpd1 PE=1 SV=3 Back     alignment and function description
>sp|Q5RCE0|GPDA_PONAB Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic OS=Pongo abelii GN=GPD1 PE=2 SV=3 Back     alignment and function description
>sp|Q3ULJ0|GPD1L_MOUSE Glycerol-3-phosphate dehydrogenase 1-like protein OS=Mus musculus GN=Gpd1l PE=1 SV=2 Back     alignment and function description

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query419
TAIR|locus:2168758400 GPDHp "Glycerol-3-phosphate de 0.871 0.912 0.820 9.3e-162
UNIPROTKB|Q5EA88349 GPD1 "Glycerol-3-phosphate deh 0.813 0.977 0.531 3e-92
UNIPROTKB|J9NS24434 GPD1L "Uncharacterized protein 0.813 0.785 0.528 2.1e-91
UNIPROTKB|P21695349 GPD1 "Glycerol-3-phosphate deh 0.813 0.977 0.528 2.1e-91
UNIPROTKB|F1P0W8380 GPD1L "Uncharacterized protein 0.813 0.897 0.523 1.2e-90
MGI|MGI:95679349 Gpd1 "glycerol-3-phosphate deh 0.813 0.977 0.531 1.9e-90
UNIPROTKB|Q8N335351 GPD1L "Glycerol-3-phosphate de 0.813 0.971 0.526 3.1e-90
UNIPROTKB|I3LLU0351 GPD1L "Uncharacterized protein 0.813 0.971 0.528 3.1e-90
RGD|621381349 Gpd1 "glycerol-3-phosphate deh 0.773 0.928 0.553 3.1e-90
UNIPROTKB|A6QQR7351 GPD1L "GPD1L protein" [Bos tau 0.813 0.971 0.528 4e-90
TAIR|locus:2168758 GPDHp "Glycerol-3-phosphate dehydrogenase plastidic" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1575 (559.5 bits), Expect = 9.3e-162, P = 9.3e-162
 Identities = 306/373 (82%), Positives = 335/373 (89%)

Query:    34 MAPAFEDNNSETLPSSFSSGSDDGVLHKSKVTVVGSGNWGSVASKLIASNTLRLSSFHDE 93
             M+PA E +         + G +D    KSKVTVVGSGNWGSVA+KLIASN L+L SFHDE
Sbjct:    35 MSPALEKSRQG------NGGCNDD--SKSKVTVVGSGNWGSVAAKLIASNALKLPSFHDE 86

Query:    94 VRMWVFEETLPSGEKLTDVINRTNENVKYLPGIKLGKNVVADPDLENAVKDANMLVFVTP 153
             VRMWVFEE LP+GEKL DVIN+TNENVKYLPGIKLG+NVVADPDLENAVKDANMLVFVTP
Sbjct:    87 VRMWVFEEVLPNGEKLNDVINKTNENVKYLPGIKLGRNVVADPDLENAVKDANMLVFVTP 146

Query:   154 HQFMEGICKRLVGKVNGDVEAISLIKGMEVKREGPCMISTLISEQLGVSCCVLMGANIAN 213
             HQFM+GICK+L GK+ GDVEAISL+KGMEVK+EGPCMIS+LIS+QLG++CCVLMGANIAN
Sbjct:   147 HQFMDGICKKLDGKITGDVEAISLVKGMEVKKEGPCMISSLISKQLGINCCVLMGANIAN 206

Query:   214 EIAVEKFSEATVGYRDNREIAEKWVQLFSTPYFMVTAVQDVEGVELCGTLKNVVAIAAGF 273
             EIAVEKFSEATVGYR +REIA+ WVQLFSTPYFMVT V DVEGVELCGTLKNVVAIAAGF
Sbjct:   207 EIAVEKFSEATVGYRGSREIADTWVQLFSTPYFMVTPVHDVEGVELCGTLKNVVAIAAGF 266

Query:   274 VDGLEMGNNTKAAIMRIGLREMRAFSKLLFSSVKDSTFFESCGVADLITTCLGGRNRKVA 333
             VDGLEMGNNTKAAIMRIGLREM+A SKLLF SVKDSTFFESCGVAD+ITTCLGGRNR+VA
Sbjct:   267 VDGLEMGNNTKAAIMRIGLREMKALSKLLFPSVKDSTFFESCGVADVITTCLGGRNRRVA 326

Query:   334 EAFAKNEGKRSFDDLEAEMLQGQKLQGVSTAREVYEVLSHRGWLELFPLFATVHEICVGH 393
             EAFAK+ GKRSFD+LEAEMLQGQKLQGVSTAREVYEVL H GWLE+FPLF+TVH+IC G 
Sbjct:   327 EAFAKSRGKRSFDELEAEMLQGQKLQGVSTAREVYEVLKHCGWLEMFPLFSTVHQICTGR 386

Query:   394 LPPSAIVEYSERK 406
             L P AIV+Y E K
Sbjct:   387 LQPEAIVQYRENK 399
GO:0000166 "nucleotide binding" evidence=IEA
GO:0004367 "glycerol-3-phosphate dehydrogenase [NAD+
GO:0005737 "cytoplasm" evidence=IEA
GO:0006072 "glycerol-3-phosphate metabolic process" evidence=ISS
GO:0009331 "glycerol-3-phosphate dehydrogenase complex" evidence=IEA;ISS
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0016614 "oxidoreductase activity, acting on CH-OH group of donors" evidence=IEA
GO:0016616 "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor" evidence=IEA
GO:0042803 "protein homodimerization activity" evidence=IEA
GO:0046167 "glycerol-3-phosphate biosynthetic process" evidence=IDA
GO:0050662 "coenzyme binding" evidence=IEA
GO:0051287 "NAD binding" evidence=IEA
UNIPROTKB|Q5EA88 GPD1 "Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9NS24 GPD1L "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P21695 GPD1 "Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1P0W8 GPD1L "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:95679 Gpd1 "glycerol-3-phosphate dehydrogenase 1 (soluble)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q8N335 GPD1L "Glycerol-3-phosphate dehydrogenase 1-like protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LLU0 GPD1L "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|621381 Gpd1 "glycerol-3-phosphate dehydrogenase 1 (soluble)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|A6QQR7 GPD1L "GPD1L protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q801R8GPD1L_XENLA1, ., 1, ., 1, ., 80.51290.81620.9715N/Ano
P34517GPDH2_CAEEL1, ., 1, ., 1, ., 80.47080.86150.9209yesno
Q5EA88GPDA_BOVIN1, ., 1, ., 1, ., 80.52440.81620.9799yesno
Q6P824GPD1L_XENTR1, ., 1, ., 1, ., 80.51870.81620.9715yesno
Q5R5V3GPD1L_PONAB1, ., 1, ., 1, ., 80.52020.81380.9715yesno
Q9HGY1GPD2_ZYGRO1, ., 1, ., 1, ., 80.44750.80190.8637yesno
Q9HGY2GPD1_ZYGRO1, ., 1, ., 1, ., 80.44190.80190.8379yesno
P52425GPDA_CUPLA1, ., 1, ., 1, ., 80.85240.86630.9758N/Ano
P08507GPDA_RABIT1, ., 1, ., 1, ., 80.50430.81620.9799yesno
O57656GPDA_TAKRU1, ., 1, ., 1, ., 80.50860.81620.9743N/Ano
Q9SCX9GPDA1_ARATH1, ., 1, ., 1, ., 80.82030.87110.9125yesno
Q27928GPDA_DROPS1, ., 1, ., 1, ., 80.49130.81860.9527yesno
Q5XIZ6GPD1L_DANRE1, ., 1, ., 1, ., 80.51580.81380.9715yesno
P21696GPD1_SCHPO1, ., 1, ., 1, ., 80.46510.83050.9038yesno
O35077GPDA_RAT1, ., 1, ., 1, ., 80.54710.77320.9283yesno
P21695GPDA_HUMAN1, ., 1, ., 1, ., 80.52160.81620.9799yesno
Q6FWJ7GPD2_CANGA1, ., 1, ., 1, ., 80.46300.80900.8033yesno
P13707GPDA_MOUSE1, ., 1, ., 1, ., 80.52600.81380.9770yesno
P13706GPDA_DROME1, ., 1, ., 1, ., 80.49710.81860.9449yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.10.983
4th Layer1.1.1.80.979

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.XVII.642.1
hypothetical protein (345 aa)
(Populus trichocarpa)
Predicted Functional Partners:
estExt_Genewise1_v1.C_290280
glycerol-3-phosphate O-acyltransferase (EC-2.3.1.15) (392 aa)
     •  0.900
fgenesh4_pm.C_LG_X000808
1-acylglycerol-3-phosphate O-acyltransferase (EC-2.3.1.51) (488 aa)
     •  0.899
fgenesh4_pm.C_LG_VIII000213
1-acylglycerol-3-phosphate O-acyltransferase (EC-2.3.1.51) (489 aa)
     •  0.899
fgenesh4_pg.C_LG_II001856
hypothetical protein (478 aa)
     •  0.899
eugene3.00060847
glycerol-3-phosphate acyltransferase (EC-2.3.1.51) (497 aa)
     •  0.899
eugene3.00051090
hypothetical protein (542 aa)
     •  0.899
estExt_fgenesh4_pm.C_LG_XVI0406
SubName- Full=Putative uncharacterized protein; (501 aa)
     •  0.899
estExt_fgenesh4_pm.C_LG_XIV0124
hypothetical protein (500 aa)
     •  0.899
estExt_fgenesh4_pm.C_LG_IV0573
glycerol acyltransferase family protein (375 aa)
     •  0.899
estExt_fgenesh4_pg.C_LG_IX0244
glycerol acyltransferase family protein (375 aa)
     •  0.899

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query419
TIGR03376342 TIGR03376, glycerol3P_DH, glycerol-3-phosphate deh 0.0
PTZ00345365 PTZ00345, PTZ00345, glycerol-3-phosphate dehydroge 1e-166
COG0240329 COG0240, GpsA, Glycerol-3-phosphate dehydrogenase 1e-103
PRK00094325 PRK00094, gpsA, NAD(P)H-dependent glycerol-3-phosp 8e-71
pfam07479145 pfam07479, NAD_Gly3P_dh_C, NAD-dependent glycerol- 7e-63
pfam01210157 pfam01210, NAD_Gly3P_dh_N, NAD-dependent glycerol- 5e-53
PRK12439341 PRK12439, PRK12439, NAD(P)H-dependent glycerol-3-p 3e-39
PRK14618328 PRK14618, PRK14618, NAD(P)H-dependent glycerol-3-p 1e-36
PRK14619308 PRK14619, PRK14619, NAD(P)H-dependent glycerol-3-p 5e-25
PRK14620326 PRK14620, PRK14620, NAD(P)H-dependent glycerol-3-p 7e-25
>gnl|CDD|234190 TIGR03376, glycerol3P_DH, glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information 
 Score =  531 bits (1369), Expect = 0.0
 Identities = 192/345 (55%), Positives = 241/345 (69%), Gaps = 7/345 (2%)

Query: 63  KVTVVGSGNWGSVASKLIASNTLRLS-SFHDEVRMWVFEETLPSGEKLTDVINRTNENVK 121
           +V VVGSGNWG+  +K++A N   L   F + VRMWVFEE    G  LT++IN T+ENVK
Sbjct: 1   RVAVVGSGNWGTAIAKIVAENARALPELFEESVRMWVFEEE-IEGRNLTEIINTTHENVK 59

Query: 122 YLPGIKLGKNVVADPDLENAVKDANMLVFVTPHQFMEGICKRLVGKVNGDVEAISLIKGM 181
           YLPGIKL  N+VA PDL  A K A++LVFV PHQF+EGICK+L G V  +  AIS IKG+
Sbjct: 60  YLPGIKLPANLVAVPDLVEAAKGADILVFVIPHQFLEGICKQLKGHVKPNARAISCIKGL 119

Query: 182 EVKREGPCMISTLISEQLGVSCCVLMGANIANEIAVEKFSEATVGYRDNRE---IAEKWV 238
           EV ++G  ++S +I E+LG+ C VL GAN+ANE+A EKFSE TVGYRD  +    A    
Sbjct: 120 EVSKDGVKLLSDIIEEELGIPCGVLSGANLANEVAKEKFSETTVGYRDPADFDVDARVLK 179

Query: 239 QLFSTPYFMVTAVQDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRIGLREMRAF 298
            LF  PYF V  V DV GVE+ G LKNVVAIAAGFVDGL  G+N KAA+MR GL EM  F
Sbjct: 180 ALFHRPYFRVNVVDDVAGVEIAGALKNVVAIAAGFVDGLGWGDNAKAAVMRRGLLEMIKF 239

Query: 299 SKLLFSSVKDSTFFESCGVADLITTCLGGRNRKVAEAFAKNEGKRSFDDLEAEMLQGQKL 358
           +++ F + + +  FESCGVADLITTCLGGRN KV  AFAK    +S ++LE E+L GQ L
Sbjct: 240 ARMFFPTGEVTFTFESCGVADLITTCLGGRNFKVGRAFAKT--GKSLEELEKELLNGQSL 297

Query: 359 QGVSTAREVYEVLSHRGWLELFPLFATVHEICVGHLPPSAIVEYS 403
           QGV+TA+EV+E+L ++   + FPLF  V++I    LPP  + E  
Sbjct: 298 QGVATAKEVHELLKNKNKDDEFPLFEAVYQILYEGLPPKKLPECL 342

Members of this protein family are the eukaryotic enzyme, glycerol-3-phosphate dehydrogenase (NAD(+)) (EC 1.1.1.8). Enzymatic activity for 1.1.1.8 is defined as sn-glycerol 3-phosphate + NAD(+) = glycerone phosphate + NADH. Note the very similar reactions of enzymes defined as EC 1.1.1.94 and 1.1.99.5, assigned to families of proteins in the bacteria. Length = 342
>gnl|CDD|240373 PTZ00345, PTZ00345, glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|223318 COG0240, GpsA, Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|234629 PRK00094, gpsA, NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|116100 pfam07479, NAD_Gly3P_dh_C, NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus Back     alignment and domain information
>gnl|CDD|201664 pfam01210, NAD_Gly3P_dh_N, NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus Back     alignment and domain information
>gnl|CDD|171500 PRK12439, PRK12439, NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237770 PRK14618, PRK14618, NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237771 PRK14619, PRK14619, NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|173083 PRK14620, PRK14620, NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 419
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 100.0
PTZ00345365 glycerol-3-phosphate dehydrogenase; Provisional 100.0
TIGR03376342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 100.0
PRK12439341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 100.0
KOG2711372 consensus Glycerol-3-phosphate dehydrogenase/dihyd 100.0
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 100.0
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 100.0
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 100.0
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 100.0
PRK06249313 2-dehydropantoate 2-reductase; Provisional 99.96
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 99.96
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 99.96
PRK05708305 2-dehydropantoate 2-reductase; Provisional 99.95
PRK12921305 2-dehydropantoate 2-reductase; Provisional 99.95
PRK08229341 2-dehydropantoate 2-reductase; Provisional 99.94
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 99.93
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 99.92
TIGR00745293 apbA_panE 2-dehydropantoate 2-reductase. This mode 99.92
PF07479149 NAD_Gly3P_dh_C: NAD-dependent glycerol-3-phosphate 99.91
KOG0409327 consensus Predicted dehydrogenase [General functio 99.91
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 99.88
PRK15059292 tartronate semialdehyde reductase; Provisional 99.87
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 99.86
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 99.85
TIGR01692288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 99.85
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 99.84
PLN02858 1378 fructose-bisphosphate aldolase 99.82
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 99.81
PLN02350 493 phosphogluconate dehydrogenase (decarboxylating) 99.8
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 99.79
PLN02858 1378 fructose-bisphosphate aldolase 99.79
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 99.78
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 99.76
PRK15182 425 Vi polysaccharide biosynthesis protein TviB; Provi 99.74
PTZ00142 470 6-phosphogluconate dehydrogenase; Provisional 99.74
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 99.73
PLN02353 473 probable UDP-glucose 6-dehydrogenase 99.72
PRK15057388 UDP-glucose 6-dehydrogenase; Provisional 99.71
PLN02688266 pyrroline-5-carboxylate reductase 99.71
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 99.71
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 99.68
PRK07680273 late competence protein ComER; Validated 99.64
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 99.64
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid 99.64
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 99.64
TIGR00873 467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 99.63
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 99.63
COG0677 436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas 99.6
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 99.59
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 99.57
PRK08507275 prephenate dehydrogenase; Validated 99.56
PTZ00431260 pyrroline carboxylate reductase; Provisional 99.55
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 99.53
PRK07417279 arogenate dehydrogenase; Reviewed 99.52
PRK12557342 H(2)-dependent methylenetetrahydromethanopterin de 99.52
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.51
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 99.51
PRK08655 437 prephenate dehydrogenase; Provisional 99.5
PRK07502307 cyclohexadienyl dehydrogenase; Validated 99.49
PRK06545359 prephenate dehydrogenase; Validated 99.47
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 99.46
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 99.45
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 99.43
PLN02256304 arogenate dehydrogenase 99.43
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.43
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.42
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 99.42
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.4
PRK09287 459 6-phosphogluconate dehydrogenase; Validated 99.39
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 99.38
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.38
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 99.37
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 99.34
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.33
COG2085211 Predicted dinucleotide-binding enzymes [General fu 99.33
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 99.32
TIGR00465314 ilvC ketol-acid reductoisomerase. This is the seco 99.3
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 99.28
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 99.27
PRK05479330 ketol-acid reductoisomerase; Provisional 99.26
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.24
PRK08268 507 3-hydroxy-acyl-CoA dehydrogenase; Validated 99.23
PRK14806 735 bifunctional cyclohexadienyl dehydrogenase/ 3-phos 99.19
COG1023300 Gnd Predicted 6-phosphogluconate dehydrogenase [Ca 99.19
PLN02712 667 arogenate dehydrogenase 99.18
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 99.17
PLN02712667 arogenate dehydrogenase 99.12
PRK08818370 prephenate dehydrogenase; Provisional 99.09
TIGR01724341 hmd_rel H2-forming N(5),N(10)-methenyltetrahydrome 99.09
TIGR00112245 proC pyrroline-5-carboxylate reductase. This enzym 99.05
PRK11730715 fadB multifunctional fatty acid oxidation complex 98.96
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 98.95
TIGR02440699 FadJ fatty oxidation complex, alpha subunit FadJ. 98.92
PRK02318381 mannitol-1-phosphate 5-dehydrogenase; Provisional 98.91
TIGR02437714 FadB fatty oxidation complex, alpha subunit FadB. 98.9
PRK11154708 fadJ multifunctional fatty acid oxidation complex 98.88
TIGR02441737 fa_ox_alpha_mit fatty acid oxidation complex, alph 98.87
COG0362 473 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate 98.86
PF02153258 PDH: Prephenate dehydrogenase; InterPro: IPR003099 98.83
PF08546125 ApbA_C: Ketopantoate reductase PanE/ApbA C termina 98.8
KOG2380480 consensus Prephenate dehydrogenase (NADP+) [Amino 98.78
KOG3124267 consensus Pyrroline-5-carboxylate reductase [Amino 98.74
PF07991165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 98.73
PRK12480330 D-lactate dehydrogenase; Provisional 98.71
PRK13403335 ketol-acid reductoisomerase; Provisional 98.66
PRK08269314 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.6
PRK08605332 D-lactate dehydrogenase; Validated 98.51
KOG2666 481 consensus UDP-glucose/GDP-mannose dehydrogenase [C 98.47
PRK07574385 formate dehydrogenase; Provisional 98.46
PRK06444197 prephenate dehydrogenase; Provisional 98.46
PRK06223307 malate dehydrogenase; Reviewed 98.46
PRK13243333 glyoxylate reductase; Reviewed 98.43
PLN03139386 formate dehydrogenase; Provisional 98.42
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 98.39
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 98.35
PRK13302271 putative L-aspartate dehydrogenase; Provisional 98.33
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 98.31
KOG2653 487 consensus 6-phosphogluconate dehydrogenase [Carboh 98.31
PRK06436303 glycerate dehydrogenase; Provisional 98.26
PRK13304265 L-aspartate dehydrogenase; Reviewed 98.25
PTZ00082321 L-lactate dehydrogenase; Provisional 98.24
KOG2304298 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t 98.23
cd05297423 GH4_alpha_glucosidase_galactosidase Glycoside Hydr 98.21
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 98.19
COG4007340 Predicted dehydrogenase related to H2-forming N5,N 98.16
TIGR01327525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 98.15
PTZ00117319 malate dehydrogenase; Provisional 98.14
PRK13581526 D-3-phosphoglycerate dehydrogenase; Provisional 98.13
PRK06141314 ornithine cyclodeaminase; Validated 98.1
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 98.1
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 98.08
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 98.04
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 98.03
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 98.01
PLN02928347 oxidoreductase family protein 98.0
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.99
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 97.97
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 97.96
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 97.96
PRK15438378 erythronate-4-phosphate dehydrogenase PdxB; Provis 97.96
PRK08306296 dipicolinate synthase subunit A; Reviewed 97.93
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 97.92
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 97.89
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 97.87
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 97.85
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 97.85
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 97.84
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 97.84
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 97.83
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 97.82
PRK05225 487 ketol-acid reductoisomerase; Validated 97.8
PRK05442326 malate dehydrogenase; Provisional 97.79
KOG2305313 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t 97.77
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehy 97.75
PF10100429 DUF2338: Uncharacterized protein conserved in bact 97.74
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 97.73
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 97.73
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 97.72
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.71
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 97.7
PRK06487317 glycerate dehydrogenase; Provisional 97.69
COG0569225 TrkA K+ transport systems, NAD-binding component [ 97.69
COG0059338 IlvC Ketol-acid reductoisomerase [Amino acid trans 97.69
PRK07340304 ornithine cyclodeaminase; Validated 97.69
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 97.68
PRK08618325 ornithine cyclodeaminase; Validated 97.67
PRK15076431 alpha-galactosidase; Provisional 97.67
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 97.66
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 97.66
PRK06932314 glycerate dehydrogenase; Provisional 97.65
PLN02602350 lactate dehydrogenase 97.64
PRK00048257 dihydrodipicolinate reductase; Provisional 97.64
TIGR01759323 MalateDH-SF1 malate dehydrogenase. This model repr 97.63
PLN02306386 hydroxypyruvate reductase 97.62
PRK13303265 L-aspartate dehydrogenase; Provisional 97.56
KOG0069336 consensus Glyoxylate/hydroxypyruvate reductase (D- 97.54
PF14833122 NAD_binding_11: NAD-binding of NADP-dependent 3-hy 97.54
PRK07589346 ornithine cyclodeaminase; Validated 97.53
PLN00203519 glutamyl-tRNA reductase 97.53
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 97.52
PRK00436343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 97.51
COG0039313 Mdh Malate/lactate dehydrogenases [Energy producti 97.5
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 97.5
PRK06823315 ornithine cyclodeaminase; Validated 97.5
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 97.49
PTZ00325321 malate dehydrogenase; Provisional 97.48
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.47
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 97.44
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 97.44
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 97.44
TIGR00036266 dapB dihydrodipicolinate reductase. 97.43
PRK08291330 ectoine utilization protein EutC; Validated 97.41
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 97.4
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 97.38
COG2423330 Predicted ornithine cyclodeaminase, mu-crystallin 97.36
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 97.36
PRK04148134 hypothetical protein; Provisional 97.34
PRK06046326 alanine dehydrogenase; Validated 97.33
PLN00112444 malate dehydrogenase (NADP); Provisional 97.33
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 97.33
TIGR01772312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 97.32
PRK09496 453 trkA potassium transporter peripheral membrane com 97.32
PTZ00075476 Adenosylhomocysteinase; Provisional 97.32
PRK12549284 shikimate 5-dehydrogenase; Reviewed 97.3
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 97.29
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 97.28
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 97.27
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 97.26
PF02423313 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst 97.25
PRK05086312 malate dehydrogenase; Provisional 97.24
PRK13940414 glutamyl-tRNA reductase; Provisional 97.24
PRK06407301 ornithine cyclodeaminase; Provisional 97.24
TIGR01850346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 97.21
TIGR01757387 Malate-DH_plant malate dehydrogenase, NADP-depende 97.2
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 97.2
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 97.18
PLN00106323 malate dehydrogenase 97.16
PRK08300302 acetaldehyde dehydrogenase; Validated 97.15
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 97.15
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 97.12
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 97.1
TIGR01921324 DAP-DH diaminopimelate dehydrogenase. This model r 97.1
TIGR01758324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 97.09
PRK11861 673 bifunctional prephenate dehydrogenase/3-phosphoshi 97.07
PRK13301267 putative L-aspartate dehydrogenase; Provisional 97.05
PLN02494477 adenosylhomocysteinase 97.02
COG4408431 Uncharacterized protein conserved in bacteria [Fun 97.01
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 96.99
PRK14874334 aspartate-semialdehyde dehydrogenase; Provisional 96.99
PRK06199379 ornithine cyclodeaminase; Validated 96.98
PLN02968381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 96.98
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 96.96
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 96.91
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 96.87
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 96.85
PRK05671336 aspartate-semialdehyde dehydrogenase; Reviewed 96.85
TIGR01771299 L-LDH-NAD L-lactate dehydrogenase. This model repr 96.84
COG2910211 Putative NADH-flavin reductase [General function p 96.83
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 96.82
PRK04207341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 96.81
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 96.81
COG0673342 MviM Predicted dehydrogenases and related proteins 96.79
PRK06718202 precorrin-2 dehydrogenase; Reviewed 96.76
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 96.75
COG0002349 ArgC Acetylglutamate semialdehyde dehydrogenase [A 96.74
KOG1495332 consensus Lactate dehydrogenase [Energy production 96.72
PRK06719157 precorrin-2 dehydrogenase; Validated 96.71
cd05298437 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; 96.58
TIGR03215285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati 96.57
PRK09496453 trkA potassium transporter peripheral membrane com 96.54
cd05197425 GH4_glycoside_hydrolases Glycoside Hydrases Family 96.53
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 96.53
PF13380116 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 96.5
PRK11579346 putative oxidoreductase; Provisional 96.47
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 96.42
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 96.42
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.39
cd01483143 E1_enzyme_family Superfamily of activating enzymes 96.38
PLN02383344 aspartate semialdehyde dehydrogenase 96.36
PRK03659601 glutathione-regulated potassium-efflux system prot 96.33
PRK10669558 putative cation:proton antiport protein; Provision 96.33
PRK08040336 putative semialdehyde dehydrogenase; Provisional 96.26
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 96.24
TIGR02717 447 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP 96.22
PRK11863313 N-acetyl-gamma-glutamyl-phosphate reductase; Provi 96.21
cd05296419 GH4_P_beta_glucosidase Glycoside Hydrolases Family 96.21
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 96.18
cd01486307 Apg7 Apg7 is an E1-like protein, that activates tw 96.17
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 96.14
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 96.07
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 96.05
PRK08664349 aspartate-semialdehyde dehydrogenase; Reviewed 96.03
COG0289266 DapB Dihydrodipicolinate reductase [Amino acid tra 96.02
PRK00683418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.01
CHL00194317 ycf39 Ycf39; Provisional 96.0
PF02056183 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterP 95.99
PRK08328231 hypothetical protein; Provisional 95.99
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.86
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 95.85
TIGR00978341 asd_EA aspartate-semialdehyde dehydrogenase (non-p 95.85
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.84
PRK03562621 glutathione-regulated potassium-efflux system prot 95.84
PRK12548289 shikimate 5-dehydrogenase; Provisional 95.8
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 95.79
PF0262996 CoA_binding: CoA binding domain; InterPro: IPR0037 95.77
PRK06728347 aspartate-semialdehyde dehydrogenase; Provisional 95.76
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 95.74
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.73
TIGR01296339 asd_B aspartate-semialdehyde dehydrogenase (peptid 95.72
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 95.71
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 95.68
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 95.66
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 95.64
PRK06349426 homoserine dehydrogenase; Provisional 95.59
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 95.59
PRK05600370 thiamine biosynthesis protein ThiF; Validated 95.52
PRK06598369 aspartate-semialdehyde dehydrogenase; Reviewed 95.51
TIGR01851310 argC_other N-acetyl-gamma-glutamyl-phosphate reduc 95.51
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 95.5
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 95.46
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 95.44
PRK00676338 hemA glutamyl-tRNA reductase; Validated 95.41
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 95.41
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 95.34
COG2344211 AT-rich DNA-binding protein [General function pred 95.33
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 95.32
PRK05472213 redox-sensing transcriptional repressor Rex; Provi 95.31
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 95.31
PRK10206344 putative oxidoreductase; Provisional 95.28
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 95.26
PRK06153393 hypothetical protein; Provisional 95.25
PRK07236386 hypothetical protein; Provisional 95.22
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 95.19
PRK14982340 acyl-ACP reductase; Provisional 95.18
PRK06392326 homoserine dehydrogenase; Provisional 95.16
PRK14027283 quinate/shikimate dehydrogenase; Provisional 95.15
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.12
COG1486442 CelF Alpha-galactosidases/6-phospho-beta-glucosida 95.05
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 95.04
PRK08223287 hypothetical protein; Validated 95.04
PRK06270341 homoserine dehydrogenase; Provisional 95.0
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 95.0
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 95.0
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 94.97
PRK01710458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.96
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 94.86
PRK08163396 salicylate hydroxylase; Provisional 94.81
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 94.79
KOG1502327 consensus Flavonol reductase/cinnamoyl-CoA reducta 94.78
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.77
TIGR01761343 thiaz-red thiazolinyl imide reductase. This reduct 94.71
PRK05868372 hypothetical protein; Validated 94.64
PTZ00188 506 adrenodoxin reductase; Provisional 94.59
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.58
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 94.58
PRK05678291 succinyl-CoA synthetase subunit alpha; Validated 94.57
PRK06753373 hypothetical protein; Provisional 94.56
COG0136334 Asd Aspartate-semialdehyde dehydrogenase [Amino ac 94.53
TIGR01381664 E1_like_apg7 E1-like protein-activating enzyme Gsa 94.52
PRK00141 473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.45
TIGR01019286 sucCoAalpha succinyl-CoA synthetase, alpha subunit 94.44
PRK06847375 hypothetical protein; Provisional 94.43
PF03447117 NAD_binding_3: Homoserine dehydrogenase, NAD bindi 94.41
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 94.34
PRK03369 488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.26
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 94.26
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 94.24
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 94.18
KOG0068406 consensus D-3-phosphoglycerate dehydrogenase, D-is 94.18
PRK02472447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.17
PRK12550272 shikimate 5-dehydrogenase; Reviewed 94.16
KOG2741351 consensus Dimeric dihydrodiol dehydrogenase [Carbo 94.13
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Vali 94.12
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 94.04
PRK07411390 hypothetical protein; Validated 94.02
PRK00421 461 murC UDP-N-acetylmuramate--L-alanine ligase; Provi 94.02
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 94.0
cd01489312 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit 93.89
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 93.85
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 93.8
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 93.79
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 93.76
PRK07588391 hypothetical protein; Provisional 93.76
PRK07538413 hypothetical protein; Provisional 93.75
cd01491286 Ube1_repeat1 Ubiquitin activating enzyme (E1), rep 93.75
PRK02006 498 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.72
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 93.66
PRK11908347 NAD-dependent epimerase/dehydratase family protein 93.63
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 93.62
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 93.59
PRK01390460 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.58
PLN02427386 UDP-apiose/xylose synthase 93.57
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.57
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 93.54
PRK08013400 oxidoreductase; Provisional 93.52
PRK08374336 homoserine dehydrogenase; Provisional 93.51
PRK11259376 solA N-methyltryptophan oxidase; Provisional 93.5
PRK05562223 precorrin-2 dehydrogenase; Provisional 93.46
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.42
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.32
cd01488291 Uba3_RUB Ubiquitin activating enzyme (E1) subunit 93.31
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.31
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 93.25
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 93.23
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 93.17
PRK07045388 putative monooxygenase; Reviewed 93.16
PLN00016378 RNA-binding protein; Provisional 93.1
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.1
PF03720106 UDPG_MGDP_dh_C: UDP-glucose/GDP-mannose dehydrogen 93.02
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 93.01
PRK08955334 glyceraldehyde-3-phosphate dehydrogenase; Validate 92.98
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 92.97
PRK14178279 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.97
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 92.92
PRK11728393 hydroxyglutarate oxidase; Provisional 92.91
PRK07806248 short chain dehydrogenase; Provisional 92.9
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.86
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.83
PRK06185407 hypothetical protein; Provisional 92.81
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 92.8
PRK07877 722 hypothetical protein; Provisional 92.77
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.77
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 92.71
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 92.71
TIGR01745366 asd_gamma aspartate-semialdehyde dehydrogenase, ga 92.7
PRK02705 459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.68
COG0300265 DltE Short-chain dehydrogenases of various substra 92.67
PRK14170284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.67
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 92.63
KOG1399448 consensus Flavin-containing monooxygenase [Seconda 92.61
PLN02172461 flavin-containing monooxygenase FMO GS-OX 92.6
PRK12939250 short chain dehydrogenase; Provisional 92.59
PRK14166282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.54
smart00846149 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, 92.52
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 92.51
PRK14180282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.49
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 92.45
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 92.41
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 92.41
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 92.41
PLN02516299 methylenetetrahydrofolate dehydrogenase (NADP+) 92.4
PRK14573 809 bifunctional D-alanyl-alanine synthetase A/UDP-N-a 92.38
PRK06126 545 hypothetical protein; Provisional 92.37
COG1832140 Predicted CoA-binding protein [General function pr 92.32
PRK06184 502 hypothetical protein; Provisional 92.3
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 92.27
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 92.18
PLN02214342 cinnamoyl-CoA reductase 92.18
PRK14187294 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.15
PRK06475400 salicylate hydroxylase; Provisional 92.13
PTZ00367 567 squalene epoxidase; Provisional 92.1
PLN02897345 tetrahydrofolate dehydrogenase/cyclohydrolase, put 92.08
TIGR03693 637 ocin_ThiF_like putative thiazole-containing bacter 92.07
cd05312279 NAD_bind_1_malic_enz NAD(P) binding domain of mali 92.07
TIGR03736244 PRTRC_ThiF PRTRC system ThiF family protein. A nov 92.06
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 92.04
PRK09126392 hypothetical protein; Provisional 92.01
PRK14182282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.98
PRK07208 479 hypothetical protein; Provisional 91.93
PLN02985 514 squalene monooxygenase 91.92
TIGR01082 448 murC UDP-N-acetylmuramate--alanine ligase. UDP-N-a 91.91
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 91.9
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 91.86
PLN02616364 tetrahydrofolate dehydrogenase/cyclohydrolase, put 91.82
PRK14193284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.82
PRK14171288 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.81
PLN02650351 dihydroflavonol-4-reductase 91.8
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 91.75
COG0771448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 91.75
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 91.75
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 91.64
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 91.6
PRK14181287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.58
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 91.56
PRK08132 547 FAD-dependent oxidoreductase; Provisional 91.53
PRK13535336 erythrose 4-phosphate dehydrogenase; Provisional 91.52
COG3349 485 Uncharacterized conserved protein [Function unknow 91.48
PRK05866293 short chain dehydrogenase; Provisional 91.46
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 91.46
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 91.45
PRK06194287 hypothetical protein; Provisional 91.37
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 91.37
PLN00198338 anthocyanidin reductase; Provisional 91.34
PRK04308445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.31
PRK00961342 H(2)-dependent methylenetetrahydromethanopterin de 91.3
PRK12266 508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 91.29
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 91.28
PRK04690 468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.26
PRK15116268 sulfur acceptor protein CsdL; Provisional 91.26
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 91.24
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 91.23
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 91.22
COG1233 487 Phytoene dehydrogenase and related proteins [Secon 91.22
TIGR01546333 GAPDH-II_archae glyceraldehyde-3-phosphate dehydro 91.21
PLN02852 491 ferredoxin-NADP+ reductase 91.12
PLN02358338 glyceraldehyde-3-phosphate dehydrogenase 91.1
PRK10538248 malonic semialdehyde reductase; Provisional 91.05
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 91.03
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 91.01
PTZ00383497 malate:quinone oxidoreductase; Provisional 90.97
KOG1298 509 consensus Squalene monooxygenase [Lipid transport 90.92
COG0026375 PurK Phosphoribosylaminoimidazole carboxylase (NCA 90.75
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 90.71
COG0190283 FolD 5,10-methylene-tetrahydrofolate dehydrogenase 90.69
cd08237341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 90.68
PRK12814 652 putative NADPH-dependent glutamate synthase small 90.6
KOG0023360 consensus Alcohol dehydrogenase, class V [Secondar 90.53
PRK13984604 putative oxidoreductase; Provisional 90.46
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 90.39
PLN02695370 GDP-D-mannose-3',5'-epimerase 90.29
PF03949255 Malic_M: Malic enzyme, NAD binding domain; InterPr 90.24
PRK01368454 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.24
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 90.22
PRK06182273 short chain dehydrogenase; Validated 90.2
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 90.2
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 90.2
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 90.19
PLN03075296 nicotianamine synthase; Provisional 90.15
TIGR01087433 murD UDP-N-acetylmuramoylalanine--D-glutamate liga 90.11
PRK14168297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.1
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information 
Probab=100.00  E-value=1.9e-56  Score=428.89  Aligned_cols=321  Identities=38%  Similarity=0.573  Sum_probs=303.5

Q ss_pred             cCeEEEECcchHHHHHHHHHHHcCCCCCCCCceEEEEecCCCCCCcchHHHHHHhcCcCCccCCCCccCCCeEecCCHHH
Q 014757           61 KSKVTVVGSGNWGSVASKLIASNTLRLSSFHDEVRMWVFEETLPSGEKLTDVINRTNENVKYLPGIKLGKNVVADPDLEN  140 (419)
Q Consensus        61 ~mkI~IIGaG~mG~~lA~~La~~G~~~~~~~~~V~l~~r~~~~~~~~~l~~~i~~~g~~~~~~~~~~l~~~i~~~~~~~e  140 (419)
                      +|||+|||+|+||+++|..|+++|       |+|++|.|+++.      ++.|+..+.|.+|+|++.+|.++++++|+++
T Consensus         1 ~~kI~ViGaGswGTALA~~la~ng-------~~V~lw~r~~~~------~~~i~~~~~N~~yLp~i~lp~~l~at~Dl~~   67 (329)
T COG0240           1 MMKIAVIGAGSWGTALAKVLARNG-------HEVRLWGRDEEI------VAEINETRENPKYLPGILLPPNLKATTDLAE   67 (329)
T ss_pred             CceEEEEcCChHHHHHHHHHHhcC-------CeeEEEecCHHH------HHHHHhcCcCccccCCccCCcccccccCHHH
Confidence            589999999999999999999999       999999999876      8889998889999999999999999999999


Q ss_pred             HhcCCCEEEEccCcchHHHHHHHHhccCCCCcEEEEeecCcccCCCCcccHHHHHHhHhCC-ceEEEeCcchHHHHHhcC
Q 014757          141 AVKDANMLVFVTPHQFMEGICKRLVGKVNGDVEAISLIKGMEVKREGPCMISTLISEQLGV-SCCVLMGANIANEIAVEK  219 (419)
Q Consensus       141 a~~~aDlVilavp~~~~~~vl~~l~~~l~~~tiivs~~nGi~~~~~~~~~~~~~i~~~~g~-~~~v~~gp~~a~e~~~g~  219 (419)
                      +++++|+|+++||++.++++++++.+.+.+++++|+++||+.++  +...+++++++.+|. ++.+++||++|.|+++|.
T Consensus        68 a~~~ad~iv~avPs~~~r~v~~~l~~~l~~~~~iv~~sKGie~~--t~~l~seii~e~l~~~~~~vLSGPs~A~EVa~g~  145 (329)
T COG0240          68 ALDGADIIVIAVPSQALREVLRQLKPLLLKDAIIVSATKGLEPE--TGRLLSEIIEEELPDNPIAVLSGPSFAKEVAQGL  145 (329)
T ss_pred             HHhcCCEEEEECChHHHHHHHHHHhhhccCCCeEEEEeccccCC--CcchHHHHHHHHcCCCeEEEEECccHHHHHhcCC
Confidence            99999999999999999999999998999999999999999865  578899999998874 589999999999999999


Q ss_pred             ceeEEEeecCCHHHHHHHHHHhCCCCcEEEEcCcHHHHHHHHHHHHHHHHHHHhhhcCCCCccHHHHHHHHHHHHHHHHH
Q 014757          220 FSEATVGYRDNREIAEKWVQLFSTPYFMVTAVQDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRIGLREMRAFS  299 (419)
Q Consensus       220 ~~~~~~~~~~~~~~~~~l~~ll~~~g~~~~~~~di~~~e~~~al~Ni~a~~~g~~~~~~~~~n~~~~l~~~~~~E~~~la  299 (419)
                      |+.+++++. |.+.+++++.+|++..|+++.++|+.|+|.++++||++|+++|+.+++.+|+|+.+++++++++||.+++
T Consensus       146 pta~~vas~-d~~~a~~v~~~f~~~~Frvy~~~Dv~GveigGAlKNViAIA~Gi~dGlg~G~NakaalitrGL~Em~rlg  224 (329)
T COG0240         146 PTAVVVASN-DQEAAEKVQALFSSPYFRVYTSTDVIGVEIGGALKNVIAIAAGIADGLGLGDNAKAALITRGLAEMTRLG  224 (329)
T ss_pred             CcEEEEecC-CHHHHHHHHHHhCCCcEEEEecCchhhhHHHHHHHHHHHHHHHHHHHhhcChhHHHHHHHhHHHHHHHHH
Confidence            999999998 9999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhcCCCCccchhcccCCcceeecccC--cccHHHHHHhhhccCCCCHHHHHHHHhcCCeeehHHHHHHHHHHHHHcCCC
Q 014757          300 KLLFSSVKDSTFFESCGVADLITTCLG--GRNRKVAEAFAKNEGKRSFDDLEAEMLQGQKLQGVSTAREVYEVLSHRGWL  377 (419)
Q Consensus       300 ~a~g~g~~~~~~~~~~~~~d~~~t~~~--~rn~~~g~~l~~~g~~~~~~~~~~~~~~g~~~Eg~~~~~~v~~~a~~~gv~  377 (419)
                      .++|  .+|++|.+++|+||+++||++  |||+++|..+++ |  .++++++..+  |+++||.++.+.++++++++|+ 
T Consensus       225 ~~lG--~~~~T~~gLsGlGDLilTCts~~SRN~r~G~~lg~-g--~~~~e~l~~~--g~vvEGv~t~k~v~~la~~~~i-  296 (329)
T COG0240         225 VALG--AKPETFMGLSGLGDLILTCTSPLSRNRRFGLLLGQ-G--LSLDEALEEI--GQVVEGVRTAKAVYELAKKLGI-  296 (329)
T ss_pred             HHhC--CCcchhcccccccceeEecCCCccccHHHHHHHhC-C--CCHHHHHHhc--CCeeecHHHHHHHHHHHHHcCC-
Confidence            9995  789999999999999999998  999999999998 6  5677766654  9999999999999999999999 


Q ss_pred             cCCcHHHHHHHHHhCCCCHHHHHHHHhcC
Q 014757          378 ELFPLFATVHEICVGHLPPSAIVEYSERK  406 (419)
Q Consensus       378 ~~~P~~~~~~~~l~~~~~~~~~~~~~~~~  406 (419)
                       ++|+++.+|++++++++|++.++.|...
T Consensus       297 -~mPI~~~Vy~vl~~~~~~~~~~~~L~~r  324 (329)
T COG0240         297 -EMPITEAVYRVLYEGLDPKEAIEELMGR  324 (329)
T ss_pred             -CCCHHHHHHHHHhCCCCHHHHHHHHhcc
Confidence             9999999999999999999999998653

>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>KOG2711 consensus Glycerol-3-phosphate dehydrogenase/dihydroxyacetone 3-phosphate reductase [Energy production and conversion] Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>TIGR00745 apbA_panE 2-dehydropantoate 2-reductase Back     alignment and domain information
>PF07479 NAD_Gly3P_dh_C: NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus; InterPro: IPR006109 NAD-dependent glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>KOG0409 consensus Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PRK12557 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase-related protein; Provisional Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09287 6-phosphogluconate dehydrogenase; Validated Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01724 hmd_rel H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase-related protein Back     alignment and domain information
>TIGR00112 proC pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>PRK02318 mannitol-1-phosphate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>COG0362 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF02153 PDH: Prephenate dehydrogenase; InterPro: IPR003099 Members of this family are prephenate dehydrogenases 1 Back     alignment and domain information
>PF08546 ApbA_C: Ketopantoate reductase PanE/ApbA C terminal; InterPro: IPR013752 This is the C-terminal domain of 2-dehydropantoate 2-reductases also known as ketopantoate reductases, 1 Back     alignment and domain information
>KOG2380 consensus Prephenate dehydrogenase (NADP+) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG3124 consensus Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK08269 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>KOG2666 consensus UDP-glucose/GDP-mannose dehydrogenase [Carbohydrate transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK06444 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>KOG2653 consensus 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>KOG2304 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism] Back     alignment and domain information
>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>COG4007 Predicted dehydrogenase related to H2-forming N5,N10-methylenetetrahydromethanopterin dehydrogenase [General function prediction only] Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK05225 ketol-acid reductoisomerase; Validated Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>KOG2305 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism] Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>PF10100 DUF2338: Uncharacterized protein conserved in bacteria (DUF2338); InterPro: IPR016935 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK15076 alpha-galactosidase; Provisional Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] Back     alignment and domain information
>PF14833 NAD_binding_11: NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase; PDB: 3OBB_A 3Q3C_A 2UYY_D 3G0O_A 1WP4_A 2CVZ_B 1YB4_A 3PDU_G 2I9P_D 2GF2_D Back     alignment and domain information
>PRK07589 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>PLN00112 malate dehydrogenase (NADP); Provisional Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline [] Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK06407 ornithine cyclodeaminase; Provisional Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK11861 bifunctional prephenate dehydrogenase/3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>COG4408 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK06199 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01771 L-LDH-NAD L-lactate dehydrogenase Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1495 consensus Lactate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>cd05298 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- and pagL-like glycosidases Back     alignment and domain information
>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>cd05197 GH4_glycoside_hydrolases Glycoside Hydrases Family 4 Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>PLN02383 aspartate semialdehyde dehydrogenase Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>PRK08040 putative semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>TIGR02717 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP forming), alpha domain Back     alignment and domain information
>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional Back     alignment and domain information
>cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PF02056 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterPro: IPR001088 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF02629 CoA_binding: CoA binding domain; InterPro: IPR003781 This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases Back     alignment and domain information
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>COG2344 AT-rich DNA-binding protein [General function prediction only] Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10206 putative oxidoreductase; Provisional Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK06153 hypothetical protein; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PRK06392 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG1486 CelF Alpha-galactosidases/6-phospho-beta-glucosidases, family 4 of glycosyl hydrolases [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01761 thiaz-red thiazolinyl imide reductase Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PRK05678 succinyl-CoA synthetase subunit alpha; Validated Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>COG0136 Asd Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01019 sucCoAalpha succinyl-CoA synthetase, alpha subunit Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>KOG0068 consensus D-3-phosphoglycerate dehydrogenase, D-isomer-specific 2-hydroxy acid dehydrogenase superfamily [Amino acid transport and metabolism] Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>KOG2741 consensus Dimeric dihydrodiol dehydrogenase [Carbohydrate transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PRK08374 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01488 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3 Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF03720 UDPG_MGDP_dh_C: UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain; InterPro: IPR014027 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PRK08955 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK07877 hypothetical protein; Provisional Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01745 asd_gamma aspartate-semialdehyde dehydrogenase, gamma-proteobacterial Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>smart00846 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
>PRK14573 bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>COG1832 Predicted CoA-binding protein [General function prediction only] Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>TIGR03693 ocin_ThiF_like putative thiazole-containing bacteriocin maturation protein Back     alignment and domain information
>cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1 Back     alignment and domain information
>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>TIGR01082 murC UDP-N-acetylmuramate--alanine ligase Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK13535 erythrose 4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK00961 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase; Provisional Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PLN02358 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] Back     alignment and domain information
>COG0026 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PF03949 Malic_M: Malic enzyme, NAD binding domain; InterPro: IPR012302 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e Back     alignment and domain information
>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>TIGR01087 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase Back     alignment and domain information
>PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query419
1x0x_A354 Co-Structure Of Homo Sapiens Glycerol-3-Phosphate D 5e-99
1wpq_A349 Ternary Complex Of Glycerol 3-Phosphate Dehydrogena 3e-98
2pla_A349 Crystal Structure Of Human Glycerol-3-Phosphate Deh 9e-98
1x0v_A354 Crystal Structure Of Homo Sapien Glycerol-3-Phospha 3e-96
4fgw_A391 Structure Of Glycerol-3-phosphate Dehydrogenase, Gp 2e-83
1yj8_A375 Initial Structural Analysis Of Plasmodium Falciparu 8e-76
3k96_A356 2.1 Angstrom Resolution Crystal Structure Of Glycer 1e-26
1z82_A335 Crystal Structure Of Glycerol-3-Phosphate Dehydroge 4e-24
1evy_A366 Crystal Structure Of Leishmania Mexicana Glycerol-3 1e-19
1txg_A335 Structure Of Glycerol-3-Phosphate Dehydrogenase Fro 6e-08
>pdb|1X0X|A Chain A, Co-Structure Of Homo Sapiens Glycerol-3-Phosphate Dehydrogenase 1 Complex With Nad Length = 354 Back     alignment and structure 
Iteration: 1

 Score =  357 bits (917), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 182/353 (51%), Positives = 241/353 (68%), Gaps = 5/353 (1%)
Query: 57  GVLHKSKVTVVGSGNWGSVASKLIASNTLRLSSFHDEVRMWVFEETLPSGEKLTDVINRT 116
           G +   KV +VGSGNWGS  +K++  N  +L+ F   V MWVFEE +  G+KLT++IN  
Sbjct: 4   GSMASKKVCIVGSGNWGSAIAKIVGGNAAQLAQFDPRVTMWVFEEDI-GGKKLTEIINTQ 62
Query: 117 NENVKYLPGIKLGKNVVADPDLENAVKDANMLVFVTPHQFMEGICKRLVGKVNGDVEAIS 176
           +ENVKYLPG KL  NVVA PD+  A +DA++L+FV PHQF+  IC +L G +  +   IS
Sbjct: 63  HENVKYLPGHKLPPNVVAVPDVVQAAEDADILIFVVPHQFIGKICDQLKGHLKANATGIS 122
Query: 177 LIKGMEVKREGPCMISTLISEQLGVSCCVLMGANIANEIAVEKFSEATVGYRDNREIAEK 236
           LIKG++    G  +IS +I E+LG+   VLMGANIA+E+A EKF E T+G +D  +  + 
Sbjct: 123 LIKGVDEGPNGLKLISEVIGERLGIPMSVLMGANIASEVADEKFCETTIGCKDPAQ-GQL 181
Query: 237 WVQLFSTPYFMVTAVQDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRIGLREMR 296
             +L  TP F +T VQ+V+ VE+CG LKNVVA+ AGF DGL  G+NTKAA++R+GL EM 
Sbjct: 182 LKELMQTPNFRITVVQEVDTVEICGALKNVVAVGAGFCDGLGFGDNTKAAVIRLGLMEMI 241
Query: 297 AFSKLLFSS-VKDSTFFESCGVADLITTCLGGRNRKVAEAFAKNEGKRSFDDLEAEMLQG 355
           AF+KL  S  V  +TF ESCGVADLITTC GGRNRKVAEAFA+    +S + LE E+L G
Sbjct: 242 AFAKLFCSGPVSSATFLESCGVADLITTCYGGRNRKVAEAFART--GKSIEQLEKELLNG 299
Query: 356 QKLQGVSTAREVYEVLSHRGWLELFPLFATVHEICVGHLPPSAIVEYSERKPR 408
           QKLQG  TARE+Y +L H+G ++ FPLF  V+++C    P    +   +  P 
Sbjct: 300 QKLQGPETARELYSILQHKGLVDKFPLFMAVYKVCYEGQPVGEFIHCLQNHPE 352
>pdb|1WPQ|A Chain A, Ternary Complex Of Glycerol 3-Phosphate Dehydrogenase 1 With Nad And Dihydroxyactone Length = 349 Back     alignment and structure
>pdb|2PLA|A Chain A, Crystal Structure Of Human Glycerol-3-Phosphate Dehydrogenase 1-Like Protein Length = 349 Back     alignment and structure
>pdb|1X0V|A Chain A, Crystal Structure Of Homo Sapien Glycerol-3-Phosphate Dehydrogenase 1 Length = 354 Back     alignment and structure
>pdb|4FGW|A Chain A, Structure Of Glycerol-3-phosphate Dehydrogenase, Gpd1, From Sacharomyces Cerevisiae Length = 391 Back     alignment and structure
>pdb|1YJ8|A Chain A, Initial Structural Analysis Of Plasmodium Falciparum Glycerol-3- Phosphate Dehydrogenase Length = 375 Back     alignment and structure
>pdb|3K96|A Chain A, 2.1 Angstrom Resolution Crystal Structure Of Glycerol-3-Phosphate Dehydrogenase (Gpsa) From Coxiella Burnetii Length = 356 Back     alignment and structure
>pdb|1Z82|A Chain A, Crystal Structure Of Glycerol-3-Phosphate Dehydrogenase (Tm0378) From Thermotoga Maritima At 2.00 A Resolution Length = 335 Back     alignment and structure
>pdb|1EVY|A Chain A, Crystal Structure Of Leishmania Mexicana Glycerol-3-phosphate Dehydrogenase Length = 366 Back     alignment and structure
>pdb|1TXG|A Chain A, Structure Of Glycerol-3-Phosphate Dehydrogenase From Archaeoglobus Fulgidus Length = 335 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query419
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 1e-173
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 1e-171
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 2e-69
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 4e-65
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 4e-65
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 1e-64
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 5e-20
3c7a_A404 Octopine dehydrogenase; L) stereospecific opine de 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-08
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 2e-07
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Length = 354 Back     alignment and structure
 Score =  488 bits (1258), Expect = e-173
 Identities = 182/348 (52%), Positives = 238/348 (68%), Gaps = 5/348 (1%)

Query: 61  KSKVTVVGSGNWGSVASKLIASNTLRLSSFHDEVRMWVFEETLPSGEKLTDVINRTNENV 120
             KV +VGSGNWGS  +K++  N  +L+ F   V MWVFEE +  G+KLT++IN  +ENV
Sbjct: 8   SKKVCIVGSGNWGSAIAKIVGGNAAQLAQFDPRVTMWVFEEDI-GGKKLTEIINTQHENV 66

Query: 121 KYLPGIKLGKNVVADPDLENAVKDANMLVFVTPHQFMEGICKRLVGKVNGDVEAISLIKG 180
           KYLPG KL  NVVA PD+  A +DA++L+FV PHQF+  IC +L G +  +   ISLIKG
Sbjct: 67  KYLPGHKLPPNVVAVPDVVQAAEDADILIFVVPHQFIGKICDQLKGHLKANATGISLIKG 126

Query: 181 MEVKREGPCMISTLISEQLGVSCCVLMGANIANEIAVEKFSEATVGYRDNREIAEKWVQL 240
           ++    G  +IS +I E+LG+   VLMGANIA+E+A EKF E T+G +D     +   +L
Sbjct: 127 VDEGPNGLKLISEVIGERLGIPMSVLMGANIASEVADEKFCETTIGCKD-PAQGQLLKEL 185

Query: 241 FSTPYFMVTAVQDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRIGLREMRAFSK 300
             TP F +T VQ+V+ VE+CG LKNVVA+ AGF DGL  G+NTKAA++R+GL EM AF+K
Sbjct: 186 MQTPNFRITVVQEVDTVEICGALKNVVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAK 245

Query: 301 LLF-SSVKDSTFFESCGVADLITTCLGGRNRKVAEAFAKNEGKRSFDDLEAEMLQGQKLQ 359
           L     V  +TF ESCGVADLITTC GGRNRKVAEAFA+  GK S + LE E+L GQKLQ
Sbjct: 246 LFCSGPVSSATFLESCGVADLITTCYGGRNRKVAEAFART-GK-SIEQLEKELLNGQKLQ 303

Query: 360 GVSTAREVYEVLSHRGWLELFPLFATVHEICVGHLPPSAIVEYSERKP 407
           G  TARE+Y +L H+G ++ FPLF  V+++C    P    +   +  P
Sbjct: 304 GPETARELYSILQHKGLVDKFPLFMAVYKVCYEGQPVGEFIHCLQNHP 351
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Length = 375 Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Length = 356 Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Length = 335 Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Length = 335 Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Length = 366 Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Length = 359 Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Length = 404 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Length = 245 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query419
4fgw_A391 Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxi 100.0
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 100.0
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 100.0
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 100.0
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 100.0
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 100.0
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 100.0
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 100.0
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 100.0
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 100.0
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 99.97
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 99.96
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 99.96
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 99.95
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 99.94
4a7p_A 446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 99.93
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 99.93
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 99.92
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 99.92
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 99.92
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 99.91
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 99.91
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 99.91
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 99.91
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 99.9
1vpd_A299 Tartronate semialdehyde reductase; structural geno 99.9
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 99.9
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 99.89
3c7a_A404 Octopine dehydrogenase; L) stereospecific opine de 99.88
3qha_A296 Putative oxidoreductase; seattle structural genomi 99.88
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 99.88
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 99.87
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 99.87
1yb4_A295 Tartronic semialdehyde reductase; structural genom 99.87
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 99.87
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 99.87
3g79_A 478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 99.86
4ezb_A317 Uncharacterized conserved protein; structural geno 99.84
2o3j_A 481 UDP-glucose 6-dehydrogenase; structural genomics, 99.84
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 99.84
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 99.84
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 99.83
3l6d_A306 Putative oxidoreductase; structural genomics, prot 99.82
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 99.81
2q3e_A 467 UDP-glucose 6-dehydrogenase; hexamer, structural g 99.81
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 99.8
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 99.79
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 99.79
3vtf_A 444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 99.78
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 99.78
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 99.78
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 99.77
3ojo_A431 CAP5O; rossmann fold, complex with cofactor NAD an 99.77
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 99.77
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 99.76
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 99.76
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 99.75
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 99.73
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 99.71
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 99.7
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 99.69
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 99.67
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 99.66
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 99.66
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 99.65
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 99.65
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 99.64
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 99.63
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 99.6
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 99.6
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 99.57
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 99.57
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 99.54
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 99.52
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 99.52
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 99.5
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 99.5
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 99.47
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 99.45
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 99.16
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 99.4
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 99.39
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 99.34
2wtb_A725 MFP2, fatty acid multifunctional protein (ATMFP2); 99.33
1wdk_A715 Fatty oxidation complex alpha subunit; alpha2BETA2 99.3
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 99.28
2i76_A276 Hypothetical protein; NADP, dehydrogenase, TM1727, 99.21
3fr7_A 525 Putative ketol-acid reductoisomerase (OS05G057370 99.15
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 99.07
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 99.0
3zwc_A742 Peroxisomal bifunctional enzyme; beta oxidation pa 98.9
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 98.89
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 98.83
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 98.82
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 98.77
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 98.77
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 98.76
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 98.74
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 98.71
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 98.71
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 98.7
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 98.7
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 98.68
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 98.67
1u8x_X472 Maltose-6'-phosphate glucosidase; structural genom 98.67
1obb_A 480 Maltase, alpha-glucosidase; glycosidase, sulfinic 98.66
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 98.66
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 98.64
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 98.63
1lss_A140 TRK system potassium uptake protein TRKA homolog; 98.63
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 98.62
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 98.61
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 98.6
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 98.6
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 98.59
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 98.57
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 98.56
1ygy_A529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 98.56
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 98.56
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 98.54
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 98.54
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 98.54
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 98.53
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 98.52
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 98.52
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 98.52
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 98.51
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 98.47
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 98.47
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 98.47
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 98.46
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 98.46
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 98.45
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 98.45
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 98.44
1s6y_A450 6-phospho-beta-glucosidase; hydrolase, structural 98.42
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 98.4
3fef_A450 Putative glucosidase LPLD; gulosidase, structural 98.39
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 98.39
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 98.39
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 98.37
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 98.36
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 98.35
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 98.34
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 98.34
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 98.34
3c85_A183 Putative glutathione-regulated potassium-efflux S 98.33
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 98.33
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 98.29
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 98.28
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 98.26
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 98.25
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 98.25
2d4a_B308 Malate dehydrogenase; archaea, hyperthermophIle, o 98.24
3tl2_A315 Malate dehydrogenase; center for structural genomi 98.23
2rir_A300 Dipicolinate synthase, A chain; structural genomic 98.22
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 98.21
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 98.21
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 98.2
2o4c_A380 Erythronate-4-phosphate dehydrogenase; erythronate 98.2
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 98.2
3oet_A381 Erythronate-4-phosphate dehydrogenase; structural 98.19
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 98.19
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 98.18
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 98.17
2duw_A145 Putative COA-binding protein; ligand binding prote 98.17
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 98.16
3q2i_A354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 98.15
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 98.15
3euw_A344 MYO-inositol dehydrogenase; protein structure init 98.15
3uuw_A308 Putative oxidoreductase with NAD(P)-binding rossm 98.15
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 98.14
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 98.13
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 98.13
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 98.1
3rc1_A350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 98.07
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 98.06
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 98.04
3db2_A354 Putative NADPH-dependent oxidoreductase; two domai 98.04
3e9m_A330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 98.01
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 98.0
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 98.0
4hkt_A331 Inositol 2-dehydrogenase; structural genomics, nys 97.99
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 97.98
3ec7_A357 Putative dehydrogenase; alpha-beta, structural gen 97.98
2ho3_A325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 97.98
1tlt_A319 Putative oxidoreductase (virulence factor MVIM HO; 97.96
2xxj_A310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 97.96
3evn_A329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.93
3ezy_A344 Dehydrogenase; structural genomics, unknown functi 97.92
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 97.92
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 97.91
3bio_A304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.88
3c1a_A315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 97.88
3e18_A359 Oxidoreductase; dehydrogenase, NAD-binding, struct 97.87
1id1_A153 Putative potassium channel protein; RCK domain, E. 97.87
3cea_A346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 97.87
3mz0_A344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 97.86
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 97.86
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 97.86
3ulk_A 491 Ketol-acid reductoisomerase; branched-chain amino 97.83
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 97.8
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 97.79
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 97.78
2d59_A144 Hypothetical protein PH1109; COA binding, structur 97.78
2p2s_A336 Putative oxidoreductase; YP_050235.1, structural g 97.77
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 97.76
1ydw_A362 AX110P-like protein; structural genomics, protein 97.75
2glx_A332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 97.75
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 97.73
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 97.72
1xea_A323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.72
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 97.71
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 97.67
3m2t_A359 Probable dehydrogenase; PSI, SGXNY, structural gen 97.67
3ohs_X334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 97.64
1iuk_A140 Hypothetical protein TT1466; structural genomics, 97.64
4h7p_A345 Malate dehydrogenase; ssgcid, structural G seattle 97.63
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 97.63
1h6d_A433 Precursor form of glucose-fructose oxidoreductase; 97.62
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 97.61
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 97.61
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 97.61
4had_A350 Probable oxidoreductase protein; structural genomi 97.58
3hhp_A312 Malate dehydrogenase; MDH, citric acid cycle, TCA 97.57
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 97.5
2ixa_A444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 97.5
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 97.5
1f06_A320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 97.46
3f4l_A345 Putative oxidoreductase YHHX; structural genomics, 97.46
3dty_A398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 97.45
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 97.42
3kux_A352 Putative oxidoreductase; oxidoreductase family, cs 97.42
3u3x_A361 Oxidoreductase; structural genomics, PSI-biology, 97.42
3ijp_A288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 97.42
2vt3_A215 REX, redox-sensing transcriptional repressor REX; 97.41
4g65_A 461 TRK system potassium uptake protein TRKA; structur 97.41
3moi_A387 Probable dehydrogenase; structural genomics, PSI2, 97.39
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 97.39
2nvw_A479 Galactose/lactose metabolism regulatory protein GA 97.37
3v5n_A417 Oxidoreductase; structural genomics, PSI-biology, 97.36
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 97.35
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 97.34
3e82_A364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 97.32
1zh8_A340 Oxidoreductase; TM0312, structural genomics, JO ce 97.32
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 97.31
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 97.3
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 97.29
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 97.29
4ew6_A330 D-galactose-1-dehydrogenase protein; nysgrc, PSI-b 97.28
4fb5_A393 Probable oxidoreductase protein; PSI-biology, nysg 97.28
2nu8_A288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 97.27
3u95_A 477 Glycoside hydrolase, family 4; hydrolysis, cytosol 97.27
3o9z_A312 Lipopolysaccaride biosynthesis protein WBPB; oxido 97.25
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 97.25
3i23_A349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.25
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 97.24
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 97.24
3gdo_A358 Uncharacterized oxidoreductase YVAA; structural ge 97.24
3fhl_A362 Putative oxidoreductase; NAD-binding domain, PSI-2 97.23
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 97.18
3oa2_A318 WBPB; oxidoreductase, sugar biosynthesis, dehydrog 97.18
4gqa_A412 NAD binding oxidoreductase; structural genomics, P 97.17
2nqt_A352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 97.17
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 97.17
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 97.16
3dr3_A337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 97.15
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 97.14
7mdh_A375 Protein (malate dehydrogenase); chloroplastic mala 97.13
1up7_A417 6-phospho-beta-glucosidase; hydrolase, family4 hyd 97.09
2ozp_A345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 97.08
4ina_A405 Saccharopine dehydrogenase; structural genomics, P 97.07
3oqb_A383 Oxidoreductase; structural genomics, protein struc 97.07
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 97.04
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 97.03
1ys4_A354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 97.03
3btv_A438 Galactose/lactose metabolism regulatory protein GA 97.02
4h3v_A390 Oxidoreductase domain protein; structural genomics 97.0
3ius_A286 Uncharacterized conserved protein; APC63810, silic 96.97
3ip3_A337 Oxidoreductase, putative; structural genomics, PSI 96.88
1oi7_A288 Succinyl-COA synthetase alpha chain; SCS, ligase, 96.87
5mdh_A333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 96.87
2czc_A334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 96.86
4gmf_A372 Yersiniabactin biosynthetic protein YBTU; rossmann 96.86
3upl_A446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 96.85
1xyg_A359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 96.82
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 96.77
1lc0_A294 Biliverdin reductase A; oxidoreductase, tetrapyrro 96.77
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 96.74
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 96.73
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 96.72
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 96.71
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 96.7
3ff4_A122 Uncharacterized protein; structural genomics, PSI- 96.7
4dpk_A359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 96.7
4dpl_A359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 96.7
1nvm_B312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy- 96.67
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 96.64
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 96.59
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 96.59
3mtj_A444 Homoserine dehydrogenase; rossmann-fold, PSI, MCSG 96.59
2yv1_A294 Succinyl-COA ligase [ADP-forming] subunit alpha; C 96.58
2ep5_A350 350AA long hypothetical aspartate-semialdehyde deh 96.58
1cf2_P337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 96.58
3keo_A212 Redox-sensing transcriptional repressor REX; DNA b 96.55
1b7g_O340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 96.55
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 96.55
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 96.54
2dt5_A211 AT-rich DNA-binding protein; REX, NADH, NAD, rossm 96.53
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 96.52
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 96.52
1hye_A313 L-lactate/malate dehydrogenase; nucleotide binding 96.49
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 96.49
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 96.49
1j5p_A253 Aspartate dehydrogenase; TM1643, structural genomi 96.48
3hsk_A381 Aspartate-semialdehyde dehydrogenase; candida albi 96.48
2fp4_A305 Succinyl-COA ligase [GDP-forming] alpha-chain, mit 96.47
3h2z_A382 Mannitol-1-phosphate 5-dehydrogenase; PSI- protein 96.43
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 96.42
2ejw_A332 HDH, homoserine dehydrogenase; NAD-dependent, oxid 96.41
2yv2_A297 Succinyl-COA synthetase alpha chain; COA-binding d 96.4
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 96.39
1vkn_A351 N-acetyl-gamma-glutamyl-phosphate reductase; TM178 96.38
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 96.38
1u8f_O335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 96.35
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 96.33
3do5_A327 HOM, homoserine dehydrogenase; NP_069768.1, putati 96.33
4gsl_A615 Ubiquitin-like modifier-activating enzyme ATG7; ub 96.29
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 96.28
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 96.27
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 96.25
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 96.24
1t4b_A367 Aspartate-semialdehyde dehydrogenase; asadh, HOSR, 96.23
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 96.19
3p2o_A285 Bifunctional protein fold; structural genomics, ce 96.15
3c8m_A331 Homoserine dehydrogenase; structural genomics, APC 96.15
2r00_A336 Aspartate-semialdehyde dehydrogenase; conformation 96.12
3l07_A285 Bifunctional protein fold; structural genomics, ID 96.12
2hjs_A340 USG-1 protein homolog; aspartate-semialdehyde dehy 96.1
3e5r_O337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 96.07
3pwk_A366 Aspartate-semialdehyde dehydrogenase; NADP binding 96.03
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 96.03
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 96.0
4hb9_A412 Similarities with probable monooxygenase; flavin, 96.0
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 95.99
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 95.99
3cps_A354 Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g 95.98
1lnq_A336 MTHK channels, potassium channel related protein; 95.98
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 95.98
2ph5_A 480 Homospermidine synthase; alpha-beta protein, struc 95.96
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 95.93
3vh1_A598 Ubiquitin-like modifier-activating enzyme ATG7; au 95.92
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 95.9
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 95.9
3ing_A325 Homoserine dehydrogenase; NP_394635.1, structural 95.89
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 95.88
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 95.88
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 95.83
3uw3_A377 Aspartate-semialdehyde dehydrogenase; structural g 95.74
3slg_A372 PBGP3 protein; structural genomics, seattle struct 95.71
3pzr_A370 Aspartate-semialdehyde dehydrogenase; NADP, oxidor 95.67
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 95.66
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 95.65
2yyy_A343 Glyceraldehyde-3-phosphate dehydrogenase; glyceral 95.65
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 95.61
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 95.61
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 95.51
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 95.51
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 95.47
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 95.47
3tz6_A344 Aspartate-semialdehyde dehydrogenase; asadh, ASD, 95.39
1tt5_B434 Ubiquitin-activating enzyme E1C isoform 1; cell cy 95.19
1gad_O330 D-glyceraldehyde-3-phosphate dehydrogenase; oxidor 95.16
2dvm_A439 Malic enzyme, 439AA long hypothetical malate oxido 95.16
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 95.15
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 95.05
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 95.04
4gx0_A565 TRKA domain protein; membrane protein, ION channel 95.02
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 94.97
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 94.89
3b1j_A339 Glyceraldehyde 3-phosphate dehydrogenase (NADP+); 94.86
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 94.85
2ywl_A180 Thioredoxin reductase related protein; uncharacter 94.84
1y8q_A346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 94.82
3cmc_O334 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m 94.81
2wm3_A299 NMRA-like family domain containing protein 1; unkn 94.77
2x5j_O339 E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid 94.73
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 94.72
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 94.66
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 94.66
1rm4_O337 Glyceraldehyde 3-phosphate dehydrogenase A; rossma 94.62
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 94.55
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 94.52
2d2i_A380 Glyceraldehyde 3-phosphate dehydrogenase; rossmann 94.52
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 94.48
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 94.47
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 94.44
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 94.41
1xq6_A253 Unknown protein; structural genomics, protein stru 94.39
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 94.34
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 94.33
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 94.3
1y8q_B 640 Anthracycline-, ubiquitin-like 2 activating enzyme 94.29
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 94.29
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 94.2
4hv4_A 494 UDP-N-acetylmuramate--L-alanine ligase; MURC, yers 94.18
3dme_A369 Conserved exported protein; structural genomics, P 94.12
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 94.11
2csu_A 457 457AA long hypothetical protein; structural genomi 94.1
4dgk_A 501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 94.02
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 94.0
4g65_A461 TRK system potassium uptake protein TRKA; structur 93.98
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 93.96
1ebf_A358 Homoserine dehydrogenase; dinucleotide, NAD, dimer 93.95
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 93.93
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 93.9
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 93.88
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 93.84
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 93.75
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 93.73
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 93.71
1hdg_O332 Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o 93.71
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 93.7
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 93.66
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 93.61
2yv3_A331 Aspartate-semialdehyde dehydrogenase; aspartate pa 93.57
3hn7_A 524 UDP-N-acetylmuramate-L-alanine ligase; ATP-binding 93.49
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 93.43
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 93.43
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 93.42
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 93.32
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 93.3
1pjq_A 457 CYSG, siroheme synthase; rossman fold, nucleotide 93.27
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 93.23
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 93.22
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 93.22
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 93.18
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 93.12
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 93.1
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 92.96
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 92.94
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 92.93
3iwa_A 472 FAD-dependent pyridine nucleotide-disulphide oxido 92.93
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 92.9
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 92.89
1p3d_A 475 UDP-N-acetylmuramate--alanine ligase; alpha/beta p 92.88
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 92.86
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 92.86
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 92.83
3nks_A 477 Protoporphyrinogen oxidase; FAD containing protein 92.82
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 92.78
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 92.65
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 92.62
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 92.62
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 92.57
1tt5_A 531 APPBP1, amyloid protein-binding protein 1; cell cy 92.53
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 92.52
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 92.5
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 92.48
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 92.47
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 92.46
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 92.39
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 92.31
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 92.27
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 92.24
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 92.22
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 92.17
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 92.16
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 92.14
2nvu_B805 Maltose binding protein/NEDD8-activating enzyme E1 92.11
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 92.1
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 92.1
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 92.1
2g82_O331 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G 92.1
4gx0_A565 TRKA domain protein; membrane protein, ION channel 92.1
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 92.1
2b0j_A358 5,10-methenyltetrahydromethanopterin hydrogenase; 92.04
1duv_G333 Octase-1, ornithine transcarbamoylase; enzyme-inhi 91.92
1dxh_A335 Ornithine carbamoyltransferase; transcarbamylase; 91.9
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 91.9
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 91.9
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 91.84
3tpf_A307 Otcase, ornithine carbamoyltransferase; structural 91.83
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 91.8
2f00_A 491 UDP-N-acetylmuramate--L-alanine ligase; amide bond 91.8
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 91.77
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 91.76
2gqf_A401 Hypothetical protein HI0933; structural genomics, 91.75
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 91.72
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 91.7
2cul_A232 Glucose-inhibited division protein A-related PROT 91.68
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 91.64
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 91.61
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 91.51
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 91.49
3r9u_A315 Thioredoxin reductase; structural genomics, center 91.45
2jae_A 489 L-amino acid oxidase; oxidoreductase, dimerisation 91.4
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 91.38
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 91.38
1pvv_A315 Otcase, ornithine carbamoyltransferase; dodecamer; 91.37
>4fgw_A Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxidoreductase; 2.45A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=100.00  E-value=3.9e-55  Score=436.56  Aligned_cols=346  Identities=47%  Similarity=0.771  Sum_probs=303.8

Q ss_pred             CCCcCeEEEECcchHHHHHHHHHHHcCCCCCC-CCceEEEEecCCCCCCcchHHHHHHhcCcCCccCCCCccCCCeEecC
Q 014757           58 VLHKSKVTVVGSGNWGSVASKLIASNTLRLSS-FHDEVRMWVFEETLPSGEKLTDVINRTNENVKYLPGIKLGKNVVADP  136 (419)
Q Consensus        58 ~~~~mkI~IIGaG~mG~~lA~~La~~G~~~~~-~~~~V~l~~r~~~~~~~~~l~~~i~~~g~~~~~~~~~~l~~~i~~~~  136 (419)
                      ..+..||+|||+|+||+++|..|+++|+..+. +.++|++|.|+++. ..+.+++.|+..+.|++|+|++++|+++++++
T Consensus        31 ~~~p~KI~ViGaGsWGTALA~~la~ng~~~~~~~~~~V~lw~r~~e~-~~~~~~e~in~~~~N~~YLpgv~Lp~~i~~t~  109 (391)
T 4fgw_A           31 AEKPFKVTVIGSGNWGTTIAKVVAENCKGYPEVFAPIVQMWVFEEEI-NGEKLTEIINTRHQNVKYLPGITLPDNLVANP  109 (391)
T ss_dssp             --CCEEEEEECCSHHHHHHHHHHHHHHHHCTTTEEEEEEEECCCCBS-SSCBHHHHHTTTCCBTTTBTTCCCCSSEEEES
T ss_pred             cCCCCeEEEECcCHHHHHHHHHHHHcCCCccccCCceEEEEEcchHh-hhHHHHHHHHhcCcCcccCCCCcCCCCcEEeC
Confidence            34456999999999999999999999821000 00259999999864 34566889999999999999999999999999


Q ss_pred             CHHHHhcCCCEEEEccCcchHHHHHHHHhccCCCCcEEEEeecCcccCCCCcccHHHHHHhHhCCceEEEeCcchHHHHH
Q 014757          137 DLENAVKDANMLVFVTPHQFMEGICKRLVGKVNGDVEAISLIKGMEVKREGPCMISTLISEQLGVSCCVLMGANIANEIA  216 (419)
Q Consensus       137 ~~~ea~~~aDlVilavp~~~~~~vl~~l~~~l~~~tiivs~~nGi~~~~~~~~~~~~~i~~~~g~~~~v~~gp~~a~e~~  216 (419)
                      |+++++.++|+||++||++.++++++++.+++++++++|+++||+...+.....+++++.+.++.++.+++||++|.|++
T Consensus       110 dl~~al~~ad~ii~avPs~~~r~~l~~l~~~~~~~~~iv~~~KGie~~~~~~~~~se~i~e~~~~~~~vLsGPs~A~EVa  189 (391)
T 4fgw_A          110 DLIDSVKDVDIIVFNIPHQFLPRICSQLKGHVDSHVRAISCLKGFEVGAKGVQLLSSYITEELGIQCGALSGANIATEVA  189 (391)
T ss_dssp             CHHHHHTTCSEEEECSCGGGHHHHHHHHTTTSCTTCEEEECCCSCEEETTEEECHHHHHHHHHCCEEEEEECSCCHHHHH
T ss_pred             CHHHHHhcCCEEEEECChhhhHHHHHHhccccCCCceeEEeccccccccccchhHHHHHHHHhCccceeccCCchHHHhh
Confidence            99999999999999999999999999999999999999999999986543346789999988888899999999999999


Q ss_pred             hcCceeEEEeecC--------CHHHHHHHHHHhCCCCcEEEEcCcHHHHHHHHHHHHHHHHHHHhhhcCCCCccHHHHHH
Q 014757          217 VEKFSEATVGYRD--------NREIAEKWVQLFSTPYFMVTAVQDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIM  288 (419)
Q Consensus       217 ~g~~~~~~~~~~~--------~~~~~~~l~~ll~~~g~~~~~~~di~~~e~~~al~Ni~a~~~g~~~~~~~~~n~~~~l~  288 (419)
                      .+.|+.+++++..        ++...+.++++|.+.+|+++.++|+.|+|+++++||++|+++|+++++++|+|+.++++
T Consensus       190 ~~~pta~~iA~~~~~~~~~~~~~~~a~~~~~lf~~~~frvy~s~DviGvElgGAlKNViAIAaGi~dGlg~G~NakAALi  269 (391)
T 4fgw_A          190 QEHWSETTVAYHIPKDFRGEGKDVDHKVLKALFHRPYFHVSVIEDVAGISICGALKNVVALGCGFVEGLGWGNNASAAIQ  269 (391)
T ss_dssp             TTCCEEEEEECCCCTTCCCSSSSCCHHHHHHHHCBTTEEEEEESCHHHHHHHHHHHHHHHHHHHHHHHTTCHHHHHHHHH
T ss_pred             cCCCceEEEEecChhhhhhhhHHHHHHHHHHHhCCCCEEEEEeCCccceehHHHHHHHHHHHHHHHhcCCCCCCHHHHHH
Confidence            9999999998751        11235779999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHhcC-CCCccchhcccCCcceeecccCcccHHHHHHhhhccCCCCHHHHHHHHhcCCeeehHHHHHHH
Q 014757          289 RIGLREMRAFSKLLFS-SVKDSTFFESCGVADLITTCLGGRNRKVAEAFAKNEGKRSFDDLEAEMLQGQKLQGVSTAREV  367 (419)
Q Consensus       289 ~~~~~E~~~la~a~g~-g~~~~~~~~~~~~~d~~~t~~~~rn~~~g~~l~~~g~~~~~~~~~~~~~~g~~~Eg~~~~~~v  367 (419)
                      +++++||.+++++++. |.++.+|.+++|+||+++||++|||+++|..++++|  ++++++++.+.+|+++||.++.+.+
T Consensus       270 trGl~Em~rlg~al~~~g~~~tt~~glaGlGDLi~Tc~sSRNr~~G~~lg~~G--~~~~~~~~~~~~g~v~EGv~ta~~v  347 (391)
T 4fgw_A          270 RVGLGEIIRFGQMFFPESREETYYQESAGVADLITTCAGGRNVKVARLMATSG--KDAWECEKELLNGQSAQGLITCKEV  347 (391)
T ss_dssp             HHHHHHHHHHHHHHSTTCCHHHHHHSTTTHHHHHHHHHSSHHHHHHHHHHHTC--CCHHHHHHHHHTTCCCTHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHhcccCCceeecCCCcccceeEEecCCccHHHHHHHHhcC--CCHHHHHHHHhCCCEEehHHHHHHH
Confidence            9999999999999943 334545778999999999999999999999999635  6788888887789999999999999


Q ss_pred             HHHHHHcCCCcCCcHHHHHHHHHhCCCCHHHHHHHHhcC
Q 014757          368 YEVLSHRGWLELFPLFATVHEICVGHLPPSAIVEYSERK  406 (419)
Q Consensus       368 ~~~a~~~gv~~~~P~~~~~~~~l~~~~~~~~~~~~~~~~  406 (419)
                      +++++++|+..++|+++.+|++++++++|+++.+.+++.
T Consensus       348 ~~l~~~~~v~~emPI~~~vy~IL~~~~~~~~~~~~l~~~  386 (391)
T 4fgw_A          348 HEWLETCGSVEDFPLFEAVYQIVYNNYPMKNLPDMIEEL  386 (391)
T ss_dssp             HHHHHHHTCSTTCHHHHHHHHHHHSCCCSTTHHHHHCC-
T ss_pred             HHHHHHcCCCCCCCHHHHHHHHHhCCCCHHHHHHHHHhc
Confidence            999999998557999999999999999999999988763
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG glucosidase, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>1obb_A Maltase, alpha-glucosidase; glycosidase, sulfinic acid, NAD+, maltose, hydrolase; HET: MAL NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>1s6y_A 6-phospho-beta-glucosidase; hydrolase, structural genomics, PSI, protein structure initi midwest center for structural genomics; 2.31A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>3ulk_A Ketol-acid reductoisomerase; branched-chain amino acid biosynthesis, rossmann fold, acetolactate, oxidoreductase; HET: CSX NDP; 2.30A {Escherichia coli} PDB: 1yrl_A* Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>3u95_A Glycoside hydrolase, family 4; hydrolysis, cytosol; 2.00A {Thermotoga neapolitana} PDB: 1vjt_A* Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>7mdh_A Protein (malate dehydrogenase); chloroplastic malate dehydrogenase (NADP+), activated by LIG chloroplastic malate dehydrogenase; 2.40A {Sorghum bicolor} SCOP: c.2.1.5 d.162.1.1 PDB: 1civ_A* Back     alignment and structure
>1up7_A 6-phospho-beta-glucosidase; hydrolase, family4 hydrolase, Na dependent; HET: G6P NAD; 2.4A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 PDB: 1up6_A* 1up4_A Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A Back     alignment and structure
>4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Back     alignment and structure
>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* Back     alignment and structure
>4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} Back     alignment and structure
>2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A* Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>2dt5_A AT-rich DNA-binding protein; REX, NADH, NAD, rossmann fold, redox sensing, winged helix, themophilus; HET: NAD; 2.16A {Thermus thermophilus} SCOP: a.4.5.38 c.2.1.12 PDB: 1xcb_A* 3ikt_A* 3ikv_A 3il2_A* Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* Back     alignment and structure
>3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} Back     alignment and structure
>2fp4_A Succinyl-COA ligase [GDP-forming] alpha-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.2.1.8 c.23.4.1 PDB: 2fpg_A* 2fpi_A* 2fpp_A* 1euc_A* 1eud_A* Back     alignment and structure
>3h2z_A Mannitol-1-phosphate 5-dehydrogenase; PSI- protein structure initiative, structural genomics, midwest for structural genomics (MCSG); 1.90A {Shigella flexneri 2a str} Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} Back     alignment and structure
>2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix} Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>3do5_A HOM, homoserine dehydrogenase; NP_069768.1, putative homoserine dehydrogenase, structural G joint center for structural genomics, JCSG; 2.20A {Archaeoglobus fulgidus} Back     alignment and structure
>4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>3c8m_A Homoserine dehydrogenase; structural genomics, APC89447, PS protein structure initiative, midwest center for structural genomics; HET: MSE; 1.90A {Thermoplasma volcanium GSS1} PDB: 3jsa_A* Back     alignment and structure
>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Back     alignment and structure
>3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>3ing_A Homoserine dehydrogenase; NP_394635.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: NDP; 1.95A {Thermoplasma acidophilum} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>3uw3_A Aspartate-semialdehyde dehydrogenase; structural genomics, seattle structural genomics center for infectious disease (ssgcid); 1.55A {Burkholderia thailandensis} Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>3pzr_A Aspartate-semialdehyde dehydrogenase; NADP, oxidoreductase-oxidoreductase inhibitor complex; HET: NAP; 1.75A {Vibrio cholerae} PDB: 1mc4_A 1mb4_A* 3q0e_A Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3tz6_A Aspartate-semialdehyde dehydrogenase; asadh, ASD, ASA, amino-acid biosynthesis, diaminopimelate biosynthesis, lysine biosynthesis; HET: SO4; 1.95A {Mycobacterium tuberculosis} PDB: 3vos_A* 3kub_A 3llg_A Back     alignment and structure
>1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Back     alignment and structure
>1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Back     alignment and structure
>3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>1rm4_O Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fold, GAPDH-NADP complex, oxidoreductase; HET: NDP; 2.00A {Spinacia oleracea} SCOP: c.2.1.3 d.81.1.1 PDB: 1nbo_O* 2hki_A 2pkq_P* 1rm5_O* 1rm3_O* 2pkr_O* 1jn0_O* 3qv1_A* 3k2b_A* 3rvd_A* 2pkq_O* Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>2csu_A 457AA long hypothetical protein; structural genomics, PH0766, riken ST genomics/proteomics initiative, RSGI, NPPSFA; 2.20A {Pyrococcus horikoshii} SCOP: c.2.1.8 c.23.4.1 c.23.4.1 Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>1ebf_A Homoserine dehydrogenase; dinucleotide, NAD, dimer, oxidoreductase; HET: NAD; 2.30A {Saccharomyces cerevisiae} SCOP: c.2.1.3 d.81.1.2 PDB: 1ebu_A* 1tve_A* 1q7g_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>2yv3_A Aspartate-semialdehyde dehydrogenase; aspartate pathway, structural genomics; 2.70A {Thermus thermophilus} Back     alignment and structure
>3hn7_A UDP-N-acetylmuramate-L-alanine ligase; ATP-binding, nucleotide-binding, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.65A {Psychrobacter arcticus 273-4} Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>1p3d_A UDP-N-acetylmuramate--alanine ligase; alpha/beta protein; HET: UMA ANP; 1.70A {Haemophilus influenzae} SCOP: c.5.1.1 c.59.1.1 c.72.2.1 PDB: 1gqq_A* 1p31_A* 1gqy_A* Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>2g82_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G3PDH, glycolysis, oxidoreductase, NAD, rossmann fold; HET: NAD PGE; 1.65A {Thermus aquaticus} SCOP: c.2.1.3 d.81.1.1 PDB: 1cer_O* 1vc2_A* Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>2b0j_A 5,10-methenyltetrahydromethanopterin hydrogenase; rossmann fold, helix bundle, oxidoreductase; 1.75A {Methanocaldococcus jannaschii} SCOP: a.100.1.11 c.2.1.6 PDB: 3f47_A* 3daf_A* 3dag_A* 3f46_A* 3h65_A* Back     alignment and structure
>1duv_G Octase-1, ornithine transcarbamoylase; enzyme-inhibitor complex, transferase; HET: PSQ; 1.70A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1akm_A* 2otc_A* Back     alignment and structure
>1dxh_A Ornithine carbamoyltransferase; transcarbamylase; 2.50A {Pseudomonas aeruginosa} SCOP: c.78.1.1 c.78.1.1 PDB: 1ort_A Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>3tpf_A Otcase, ornithine carbamoyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, rossman fold; 2.70A {Campylobacter jejuni subsp} Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>2f00_A UDP-N-acetylmuramate--L-alanine ligase; amide bond ligase, ATPase, bacterial cell WALL; 2.50A {Escherichia coli} Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>1pvv_A Otcase, ornithine carbamoyltransferase; dodecamer; 1.87A {Pyrococcus furiosus} SCOP: c.78.1.1 c.78.1.1 PDB: 1a1s_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 419
d1n1ea1160 a.100.1.6 (A:198-357) Glycerol-3-phosphate dehydro 5e-30
d1n1ea2189 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogen 6e-29
d1txga1155 a.100.1.6 (A:181-335) Glycerol-3-phosphate dehydro 4e-27
d1txga2180 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogen 8e-16
d1vjta1193 c.2.1.5 (A:-1-191) Putative alpha-glucosidase TM07 7e-05
d1bg6a2184 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvalin 4e-04
>d1n1ea1 a.100.1.6 (A:198-357) Glycerol-3-phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Length = 160 Back     information, alignment and structure

class: All alpha proteins
fold: 6-phosphogluconate dehydrogenase C-terminal domain-like
superfamily: 6-phosphogluconate dehydrogenase C-terminal domain-like
family: Glycerol-3-phosphate dehydrogenase
domain: Glycerol-3-phosphate dehydrogenase
species: Trypanosome (Leishmania mexicana) [TaxId: 5665]

 Score =  111 bits (279), Expect = 5e-30
 Identities = 38/149 (25%), Positives = 59/149 (39%), Gaps = 7/149 (4%)

Query: 253 DVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRIGLREMRAFSKLLFSSVKDSTFF 312
           D  G E+   +KNV+AI +G  +GL MG N +AA++  GL E+R  +         S  F
Sbjct: 2   DTVGCEVASAVKNVLAIGSGVANGLGMGLNARAALIMRGLLEIRDLTA--ALGGDGSAVF 59

Query: 313 ESCGVADLITTCLGGRNRKVAEAFAKNEGKRSFDDLEAEMLQGQKLQGVSTAREVYEVLS 372
              G+ DL  TC    +R            +     E +       +GV+TA  +  +  
Sbjct: 60  GLAGLGDLQLTCSSELSRNFTVGKKLG---KGLPIEEIQRTSKAVAEGVATADPLMRLAK 116

Query: 373 HRGWLELFPLFATVHEICVGHLPPSAIVE 401
                   PL   ++EI      P   + 
Sbjct: 117 QLKV--KMPLCHQIYEIVYKKKNPRDALA 143
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Length = 189 Back     information, alignment and structure
>d1txga1 a.100.1.6 (A:181-335) Glycerol-3-phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 155 Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 180 Back     information, alignment and structure
>d1vjta1 c.2.1.5 (A:-1-191) Putative alpha-glucosidase TM0752 {Thermotoga maritima [TaxId: 2336]} Length = 193 Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Length = 184 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query419
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 99.95
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 99.91
d1n1ea1160 Glycerol-3-phosphate dehydrogenase {Trypanosome (L 99.91
d1txga1155 Glycerol-3-phosphate dehydrogenase {Archaeoglobus 99.9
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 99.73
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 99.71
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 99.71
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 99.68
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 99.67
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 99.65
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 99.61
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 99.52
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 99.51
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 99.45
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 99.45
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 99.41
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 99.41
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 99.4
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 99.37
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 99.31
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 99.24
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 98.94
d1ks9a1124 Ketopantoate reductase PanE {Escherichia coli [Tax 98.85
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 98.79
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 98.65
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 98.61
d2b0ja2242 5,10-methenyltetrahydromethanopterin hydrogenase, 98.58
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 98.52
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 98.44
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 98.42
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 98.4
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 98.39
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 98.36
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 98.35
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 98.31
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 98.25
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 98.23
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 98.22
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 98.17
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 98.17
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 98.17
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 98.17
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 98.14
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 98.14
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 98.12
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 98.11
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 98.08
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 98.08
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 98.07
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 98.06
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 98.06
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 98.06
d1qmga2226 Class II ketol-acid reductoisomerase (KARI) {Spina 98.05
d1np3a2182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 98.02
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 97.99
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 97.98
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 97.92
d1vpda1133 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 97.9
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 97.89
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 97.89
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 97.88
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 97.87
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 97.85
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 97.79
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 97.79
d2cvza1132 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 97.76
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 97.72
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 97.67
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 97.64
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 97.62
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 97.59
d3cuma1134 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 97.58
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 97.54
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 97.53
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 97.45
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 97.41
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 97.35
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 97.34
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 97.3
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 97.3
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 97.3
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 97.27
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 97.19
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 97.16
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 97.14
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 97.14
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 97.13
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 97.1
d1x7da_340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 97.04
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 97.03
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 97.02
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 96.99
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 96.98
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 96.98
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 96.94
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 96.89
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 96.88
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 96.83
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 96.82
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 96.75
d1omoa_320 Archaeal alanine dehydrogenase {Archaeon Archaeogl 96.69
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 96.59
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 96.58
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 96.47
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus 96.44
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 96.39
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 96.3
d2nvwa1237 Galactose/lactose metabolism regulatory protein GA 96.25
d1id1a_153 Rck domain from putative potassium channel Kch {Es 96.21
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 96.21
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.2
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 96.15
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 96.11
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 96.05
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 96.0
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 95.96
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 95.94
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 95.93
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 95.91
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 95.87
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 95.73
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 95.73
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 95.72
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 95.7
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 95.59
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 95.58
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 95.54
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 95.49
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 95.47
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 95.44
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 95.43
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 95.43
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 95.35
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 95.23
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 95.17
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 95.17
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 95.16
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 95.12
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 95.06
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 95.04
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 95.0
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 95.0
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 95.0
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 94.9
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 94.87
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 94.86
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 94.85
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 94.76
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 94.74
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 94.71
d1yovb1426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 94.65
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.64
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.61
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 94.56
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 94.55
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 94.52
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 94.5
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 94.49
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 94.43
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 94.28
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 94.28
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 94.26
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 94.25
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 94.17
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 94.13
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 94.13
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 94.1
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 94.04
d1mv8a3136 GDP-mannose 6-dehydrogenase, GDP-binding domain {P 93.98
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 93.98
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 93.77
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 93.74
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 93.73
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 93.46
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 93.39
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 93.31
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 93.27
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 93.15
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 93.12
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 93.0
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 92.73
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 92.69
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 92.66
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 92.63
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 92.6
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 92.52
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 92.46
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 92.19
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 92.15
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 92.07
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 91.95
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 91.56
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 91.51
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 91.51
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 91.46
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 91.28
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 91.16
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 91.12
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 90.75
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 90.75
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 90.68
d1vl6a1222 Malate oxidoreductase (malic enzyme) {Thermotoga m 90.54
d1w5fa1194 Cell-division protein FtsZ {Thermotoga maritima [T 90.54
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 90.4
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 90.34
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 90.04
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 89.9
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 89.86
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 89.82
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 89.75
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 89.74
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 89.65
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 89.37
d2vapa1209 Cell-division protein FtsZ {Archaeon Methanococcus 89.05
d1yova1 529 Amyloid beta precursor protein-binding protein 1, 89.04
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 89.02
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 88.98
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 88.9
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 88.83
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 88.78
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 88.74
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 88.72
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 88.63
d1rq2a1198 Cell-division protein FtsZ {Mycobacterium tubercul 88.33
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 88.31
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 88.19
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 88.16
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 88.07
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 88.06
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 88.0
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 87.72
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 87.71
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 87.6
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 87.38
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 87.3
d1mv8a198 GDP-mannose 6-dehydrogenase, middle domain {Pseudo 87.2
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 87.06
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 86.87
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 86.86
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 86.73
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 86.71
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 86.48
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 86.47
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 86.45
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 86.44
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 86.35
d1ml4a2157 Aspartate carbamoyltransferase catalytic subunit { 86.32
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 86.16
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 86.11
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 86.08
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 86.07
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 85.93
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 85.67
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 85.65
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 85.63
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 85.38
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 85.36
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 85.2
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 85.18
d2bw0a2203 10-formyltetrahydrofolate dehydrogenase domain 1 { 85.09
d1dxha2185 Ornithine transcarbamoylase {Pseudomonas aeruginos 84.92
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 84.84
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 84.65
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 84.32
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 84.31
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 84.18
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 84.13
d1b26a1234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 84.08
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 84.08
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 84.08
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 83.78
d1pvva2163 Ornithine transcarbamoylase {Archaeon Pyrococcus f 83.65
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 83.55
d1ekxa2160 Aspartate carbamoyltransferase catalytic subunit { 83.54
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 83.37
d1gado1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 83.05
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 82.98
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 82.88
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 82.83
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 82.8
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 82.67
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 82.49
d1rm4a1172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 82.49
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 82.4
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 82.4
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 82.26
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 82.26
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 82.24
d1vkza290 Glycinamide ribonucleotide synthetase (GAR-syn), N 82.18
d1vlva2161 Ornithine transcarbamoylase {Thermotoga maritima [ 82.1
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 82.01
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 81.98
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 81.89
d1obfo1173 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 81.85
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 81.85
d1ofua1198 Cell-division protein FtsZ {Pseudomonas aeruginosa 81.78
d1euca1130 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 81.68
d1duvg2183 Ornithine transcarbamoylase {Escherichia coli [Tax 81.64
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 81.62
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 81.6
d1k3ta1190 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 81.47
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 81.37
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 81.21
d1pg5a2153 Aspartate carbamoyltransferase catalytic subunit { 81.16
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 81.03
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 80.85
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 80.82
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 80.45
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 80.35
d2nu7a1119 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 80.02
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: 6-phosphogluconate dehydrogenase-like, N-terminal domain
domain: Glycerol-3- phosphate dehydrogenase
species: Trypanosome (Leishmania mexicana) [TaxId: 5665]

Probab=99.95  E-value=1.6e-28  Score=220.52  Aligned_cols=177  Identities=28%  Similarity=0.460  Sum_probs=158.6

Q ss_pred             CCCcCeEEEECcchHHHHHHHHHHHcCCCCCCCCceEEEEecCCCCCCcchHHHHHHhcCcCCccCCCCccCCCeEecCC
Q 014757           58 VLHKSKVTVVGSGNWGSVASKLIASNTLRLSSFHDEVRMWVFEETLPSGEKLTDVINRTNENVKYLPGIKLGKNVVADPD  137 (419)
Q Consensus        58 ~~~~mkI~IIGaG~mG~~lA~~La~~G~~~~~~~~~V~l~~r~~~~~~~~~l~~~i~~~g~~~~~~~~~~l~~~i~~~~~  137 (419)
                      .+.|+||+|||+|+||+++|..|+++|       |+|++|+|+++.      ++.|++.+.++.|+|++.+|.++.++++
T Consensus         4 ~~~m~KI~ViGaG~wGtAlA~~La~~g-------~~V~l~~r~~~~------~~~i~~~~~n~~yl~~~~l~~~i~~t~~   70 (189)
T d1n1ea2           4 LLYLNKAVVFGSGAFGTALAMVLSKKC-------REVCVWHMNEEE------VRLVNEKRENVLFLKGVQLASNITFTSD   70 (189)
T ss_dssp             CCCEEEEEEECCSHHHHHHHHHHHTTE-------EEEEEECSCHHH------HHHHHHHTBCTTTSTTCBCCTTEEEESC
T ss_pred             cceeceEEEECCCHHHHHHHHHHHHcC-------CeEEEEEecHHH------HHHHhhcccccccccccccccccccchh
Confidence            567789999999999999999999999       999999998766      8999999999999999999999999999


Q ss_pred             HHHHhcCCCEEEEccCcchHHHHHHHHhcc-----CCCCcEEEEeecCcccCCCCcccHHHHHHhHhCC-ceEEEeCcch
Q 014757          138 LENAVKDANMLVFVTPHQFMEGICKRLVGK-----VNGDVEAISLIKGMEVKREGPCMISTLISEQLGV-SCCVLMGANI  211 (419)
Q Consensus       138 ~~ea~~~aDlVilavp~~~~~~vl~~l~~~-----l~~~tiivs~~nGi~~~~~~~~~~~~~i~~~~g~-~~~v~~gp~~  211 (419)
                      +++++.++|+||++||++.++++++++.+.     +.++.++++++||+...  +...+++++.+.++. ++.+++||++
T Consensus        71 l~~a~~~ad~iiiavPs~~~~~~~~~~~~~~~~~~~~~~~~ii~~tKGie~~--t~~~~seii~e~~~~~~~~vlsGP~~  148 (189)
T d1n1ea2          71 VEKAYNGAEIILFVIPTQFLRGFFEKSGGNLIAYAKEKQVPVLVCTKGIERS--TLKFPAEIIGEFLPSPLLSVLAGPSF  148 (189)
T ss_dssp             HHHHHTTCSCEEECSCHHHHHHHHHHHCHHHHHHHHHHTCCEEECCCSCCTT--TCCCHHHHHTTTSCGGGEEEEESSCC
T ss_pred             hhhccCCCCEEEEcCcHHHHHHHHHHHHhhhhhhhccCCcEEEEEECCCccC--CccchhhHHHHHhcccceEEEecCCc
Confidence            999999999999999999999999988753     35678899999999754  467888999887764 5789999999


Q ss_pred             HHHHHhcCceeEEEeecCCHHHHHHHHHHhCC--CCcEEEE
Q 014757          212 ANEIAVEKFSEATVGYRDNREIAEKWVQLFST--PYFMVTA  250 (419)
Q Consensus       212 a~e~~~g~~~~~~~~~~~~~~~~~~l~~ll~~--~g~~~~~  250 (419)
                      |.|+..|.|+.+++++. +.+.+++++++|++  ..|+++.
T Consensus       149 A~Ev~~~~pt~~viAs~-~~~~a~~i~~lfst~~~~frvy~  188 (189)
T d1n1ea2         149 AIEVATGVFTCVSIASA-DINVARRLQRIMSTGDRSFVCWA  188 (189)
T ss_dssp             HHHHHTTCCEEEEEECS-SHHHHHHHHHHHSCTTSSEEEEE
T ss_pred             HHHHHcCCCcEEEEEeC-CHHHHHHHHHHhCCCCCCEEEec
Confidence            99999999999999988 89999999999986  4588875
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1n1ea1 a.100.1.6 (A:198-357) Glycerol-3-phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1txga1 a.100.1.6 (A:181-335) Glycerol-3-phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1ks9a1 a.100.1.7 (A:168-291) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2b0ja2 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qmga2 c.2.1.6 (A:82-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1vpda1 a.100.1.1 (A:164-296) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d2cvza1 a.100.1.1 (A:158-289) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d3cuma1 a.100.1.1 (A:163-296) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv8a3 c.26.3.1 (A:301-436) GDP-mannose 6-dehydrogenase, GDP-binding domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w5fa1 c.32.1.1 (A:22-215) Cell-division protein FtsZ {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2vapa1 c.32.1.1 (A:23-231) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rq2a1 c.32.1.1 (A:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1mv8a1 a.100.1.4 (A:203-300) GDP-mannose 6-dehydrogenase, middle domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1ml4a2 c.78.1.1 (A:152-308) Aspartate carbamoyltransferase catalytic subunit {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2bw0a2 c.65.1.1 (A:1-203) 10-formyltetrahydrofolate dehydrogenase domain 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxha2 c.78.1.1 (A:151-335) Ornithine transcarbamoylase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1pvva2 c.78.1.1 (A:151-313) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ekxa2 c.78.1.1 (A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vkza2 c.30.1.1 (A:4-93) Glycinamide ribonucleotide synthetase (GAR-syn), N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vlva2 c.78.1.1 (A:153-313) Ornithine transcarbamoylase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1ofua1 c.32.1.1 (A:11-208) Cell-division protein FtsZ {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1euca1 c.2.1.8 (A:1-130) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1duvg2 c.78.1.1 (G:151-333) Ornithine transcarbamoylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1pg5a2 c.78.1.1 (A:147-299) Aspartate carbamoyltransferase catalytic subunit {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2nu7a1 c.2.1.8 (A:2-120) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure