Citrus Sinensis ID: 014786

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------42

MAYSLISSSTFLLSRSPNTTLAPLNKHNFPLRPSRARATAGTIICCSNSPTTSAIRSIVSKLLLFTKPSSSASSAFESLFVFCGSVVLSFTLLFSNVDSASAFVVTPQRKLQTDELATVRLFQENTPSVVNITNLAARQDAFTLDVLEVPQGSGSGFVWDSKGHVVTNYHVIRGASDIRVTFADQSAYDAKIVGFDQDKDVAVLRIDAPKDKLRPIPIGVSADLLVGQKVYAIGNPFGLDHTLTTGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGSLIGINTAIYSPSGASSGVGFSIPVDTVNGIVDQLVKFGKVTRPILGIKFAPDQSVEQLGVSGVLVLDAPPNGPAGKAGLLSTKRDAYGRLILGDIITSVNGKKVSNGSDLYRILDQCKVGDEVSCFTFL

ccccccccccCEECccccccccccccccccccccccccccccEEEEccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHcccccEEEEEEEECcccccccccccccccccEEEEccccEEEEcccccccccEEEEEEccccEEEEEEEcccccccEEEEEECccccccccEEcccccccccccEEEEEcccccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccEEEEEEEEEccccccccEEccccHHHHHHHHHHHHHccCEcccEEEEEEccHHHHHHccccEEEEEEcccccHHHHccccccccccccccccccEEEEEccCEcccHHHHHHHHHccccccEEEEEEEc

********STF**************************ATAGTIICCSNSPTTSAIRSIVSKLLLFTK**SSASSAFESLFVFCGSVVLSFTLLFSNVDSASAFVVTPQRKLQTDELATVRLFQENTPSVVNITNLAARQDAFTLDV*****GSGSGFVWDSKGHVVTNYHVIRGASDIRVTFADQSAYDAKIVGFDQDKDVAVLRIDAPKDKLRPIPIGVSADLLVGQKVYAIGNPFGLDHTLTTGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGSLIGINTAIYSPSGASSGVGFSIPVDTVNGIVDQLVKFGKVTRPILGIKFAPDQSVEQLGVSGVLVLDAPPNGPAGKAGLLSTKRDAYGRLILGDIITSVNGKKVSNGSDLYRILDQCKVGDEVSCFTFL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protease Do-like 1, chloroplastic	Serine protease that is required at high temperature. May be involved in the degradation of damaged proteins. In vivo, can degrade beta-casein.	probable	O22609

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3QO6, chain A
Confidence level:very confident
Coverage over the Query: 109-417
View the alignment between query and template
View the model in PyMOL