BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 014796
         (418 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q9SVC5|DOF35_ARATH Dof zinc finger protein DOF3.5 OS=Arabidopsis thaliana GN=DOF3.5
           PE=3 SV=1
          Length = 247

 Score = 33.1 bits (74), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 31/75 (41%), Gaps = 13/75 (17%)

Query: 123 LPPFNAENFLYLMRNKTW--ALIGDSISRNHVQSLLCMLSTVEQAVEVYHDEEYRSKRWH 180
           LPPF  E  L L  N  W  AL+   I  NHV   +  +  V + V  + DE   S    
Sbjct: 178 LPPFPGEELLSLDTNGVWSDALL---IGHNHVDVGVTPVQAVHEPVVHFADESNDSTNLL 234

Query: 181 FPSYNFSVSVIWSPF 195
           F S        WSPF
Sbjct: 235 FGS--------WSPF 241


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.319    0.136    0.432 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 166,109,402
Number of Sequences: 539616
Number of extensions: 7205841
Number of successful extensions: 16188
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 16181
Number of HSP's gapped (non-prelim): 10
length of query: 418
length of database: 191,569,459
effective HSP length: 120
effective length of query: 298
effective length of database: 126,815,539
effective search space: 37791030622
effective search space used: 37791030622
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 63 (28.9 bits)