Citrus Sinensis ID: 014798

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------42

MEASSACLVGNILTTHKTKTNLSKDFHGRHLLFNSSFRSLEKKPKVAVVKASLSQKQHEGRRGFLKKLVGNVGVGTALLGSGKAYADEQGVSSSRMSYSRFLEYLDKDRVKKVDLFENGTIAIVEAISPELGNRVQRVRVQLPGLSQELLQKFREKNIDFAAHNAQEDSGSLLFNLIGNLAFPLILIGGLFLLSRRSSGGMGGPGGPGFPLAFGQSKAKFQMEPNTGVTFDDVAGVDEAKQDFMEVVEFLKKPERFTAIGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVFVDEIDAVGRQRGTGIGGGNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLRPGRFDRQVKHVSLSLMLWFLKTHSQYKDPL

cccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHcccEEEEEEEcccEEEEEEEcccccccccEEEEEEcccccHHHHHHHHHccccEEECccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccEEccccccHHHHHHHHHHHHHccccHHHHHcccccccccEEEccccccHHHHHHHHHccccccEEEcccccEEEEcccccHHHHHHHHHHHHHccccEEEEEccccccccccccccccccHHHHHHHHHHHHcccccccccEEEEEEcccccccccccccccccccccccccHHHHHHHHHHHccccccc

******CLVGNILTTHKTKTNLSKDFHGRHLLFNSSF************************RGFLKKLVGNVGVGTALLGSGKA***********MSYSRFLEYLDKDRVKKVDLFENGTIAIVEAISPELGNRVQRVRVQLPGLSQELLQKFREKNIDFAAHNAQEDSGSLLFNLIGNLAFPLILIGGLFLLS******************************NTGVTFDDVAGVDEAKQDFMEVVEFLKKPERFTAIGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVFVDEIDAVGRQRGTGIGGGNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLRPGRFDRQVKHVSLSLMLWFLKTHSQYKDP*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
ATP-dependent zinc metalloprotease FTSH 2, chloroplastic	Probable ATP-dependent zinc metallopeptidase.	probable	Q655S1
ATP-dependent zinc metalloprotease FtsH	In vitro partially degrades Spo0E, the phosphatase that acts on Spo0A-P. Recognition requires the last 14 residues of Spo0E.	probable	P37476
ATP-dependent zinc metalloprotease FtsH	Acts as a processive, ATP-dependent zinc metallopeptidase.	probable	O78516

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DHR, chain A
Confidence level:very confident
Coverage over the Query: 217-416
View the alignment between query and template
View the model in PyMOL

Template: 2LNA, chain A
Confidence level:probable
Coverage over the Query: 92-155
View the alignment between query and template
View the model in PyMOL