BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 014838
(417 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1MG7|A Chain A, Crystal Structure Of Xol-1
pdb|1MG7|B Chain B, Crystal Structure Of Xol-1
Length = 417
Score = 28.9 bits (63), Expect = 6.1, Method: Compositional matrix adjust.
Identities = 18/55 (32%), Positives = 26/55 (47%)
Query: 171 LKNFNEIRFLRIELPSGELGIDDGVLLKWRADFGSTLDNCVILGAASVMNNVLAK 225
L N EI F SG+L + ++ W+ S D C S+MN+V+AK
Sbjct: 107 LHNVYEINFYDPLDSSGKLAVIPMLIALWKCMLASETDICDQEVLKSIMNSVIAK 161
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.320 0.137 0.410
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,658,954
Number of Sequences: 62578
Number of extensions: 369224
Number of successful extensions: 983
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 982
Number of HSP's gapped (non-prelim): 1
length of query: 417
length of database: 14,973,337
effective HSP length: 101
effective length of query: 316
effective length of database: 8,652,959
effective search space: 2734335044
effective search space used: 2734335044
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (25.0 bits)