Query         014841
Match_columns 417
No_of_seqs    113 out of 229
Neff          6.6 
Searched_HMMs 13730
Date          Mon Mar 25 18:47:09 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/014841.a3m -d /work/01045/syshi/HHdatabase/scop70.hhm -o /work/01045/syshi/hhsearch_scop/014841hhsearch_scop -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 d2e74d2 f.23.12.1 (D:12-45) IS  13.9      34  0.0025   20.1   1.2   29  253-281     5-33  (34)
  2 d1q90g_ f.23.26.1 (G:) PetG su   6.6      88  0.0064   17.8   1.1   11  264-274     6-16  (30)
  3 d2axtt1 f.23.34.1 (T:1-30) Pho   5.0 2.5E+02   0.019   15.5   2.5   20  145-164     3-22  (30)
  4 d2nwwa1 f.49.1.1 (A:12-416) Pr   3.2 1.2E+03    0.09   19.7   9.3   63   41-103    33-102 (405)
  5 d1tm9a_ a.225.1.1 (A:) Hypothe   3.1 3.8E+02   0.028   19.6   2.9   15  342-356    98-112 (137)
  6 d1tbaa_ a.15.1.1 (A:) TAF(II)2   3.0 1.7E+02   0.013   19.7   0.7   15   33-47     36-50  (67)
  7 d1v54l_ f.23.6.1 (L:) Mitochon   3.0 5.9E+02   0.043   15.6   3.7   28   69-96     14-41  (46)
  8 d1jb0m_ f.23.19.1 (M:) Subunit   2.4 2.8E+02    0.02   15.6   1.0   12  264-275     9-20  (31)
  9 d1otsa_ f.20.1.1 (A:) Clc chlo   2.4 5.4E+02   0.039   22.8   3.8   22  253-274    14-35  (444)
 10 d1q90r_ f.23.12.1 (R:) ISP sub   2.3 3.3E+02   0.024   16.4   1.2   28  253-280    10-37  (39)

No 1  
>d2e74d2 f.23.12.1 (D:12-45) ISP subunit from the cytochrome b6f complex, transmembrane anchor {Mastigocladus laminosus [TaxId: 83541]}
Probab=13.86  E-value=34  Score=20.12  Aligned_cols=29  Identities=14%  Similarity=0.400  Sum_probs=23.7

Q ss_pred             hcccChhHHHHHHHHHHhcchhhhhcccc
Q 014841          253 KMIFAPSTIAAIIGFVIGTISPFRKVIVG  281 (417)
Q Consensus       253 ~~~~~Pp~ia~ilg~iig~iP~Lr~lff~  281 (417)
                      +.|+|=-+.|.+-|...|..-|+-+-|+.
T Consensus         5 rqfmnlltfgt~tg~alg~lypvvkyfip   33 (34)
T d2e74d2           5 RQFMNLLAFGTVTGVALGALYPLVKYFIP   33 (34)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHSC
T ss_pred             HHHHHHHHHhhHHHHHHhhhhhHHhhcCC
Confidence            55666679999999999999888877764


No 2  
>d1q90g_ f.23.26.1 (G:) PetG subunit of the cytochrome b6f complex {Chlamydomonas reinhardtii [TaxId: 3055]}
Probab=6.60  E-value=88  Score=17.78  Aligned_cols=11  Identities=27%  Similarity=0.682  Sum_probs=7.7

Q ss_pred             HHHHHHhcchh
Q 014841          264 IIGFVIGTISP  274 (417)
Q Consensus       264 ilg~iig~iP~  274 (417)
                      +.|++.|+||-
T Consensus         6 l~GivlGlipi   16 (30)
T d1q90g_           6 LCGIVLGLVPV   16 (30)
T ss_dssp             HHHHHHHHHHH
T ss_pred             HHhHHHhhHHH
Confidence            46777777773


No 3  
>d2axtt1 f.23.34.1 (T:1-30) Photosystem II reaction center protein T, PsbT {Thermosynechococcus elongatus [TaxId: 146786]}
Probab=4.97  E-value=2.5e+02  Score=15.49  Aligned_cols=20  Identities=10%  Similarity=0.265  Sum_probs=14.0

Q ss_pred             hhHHHHHHHHHhHHHHhhhh
Q 014841          145 GKAYASLSMAVGAIYIWTYV  164 (417)
Q Consensus       145 G~aYi~~~~~v~~i~~~t~~  164 (417)
                      .++|+.+|.-+-+.+.|..-
T Consensus         3 ~i~yv~ifac~i~lfffaif   22 (30)
T d2axtt1           3 TITYVFIFACIIALFFFAIF   22 (30)
T ss_dssp             HHHHHHHHHHHHHHHHHHHH
T ss_pred             eeehHHHHHHHHHHHHHHHH
Confidence            36899988876666666543


No 4  
>d2nwwa1 f.49.1.1 (A:12-416) Proton glutamate symport protein {Pyrococcus horikoshii [TaxId: 53953]}
Probab=3.16  E-value=1.2e+03  Score=19.73  Aligned_cols=63  Identities=13%  Similarity=0.139  Sum_probs=42.0

Q ss_pred             hhhhhhhHh---hhhhHHHHHhhcccc-ccc--chhhhh-HHHHHHHHHHHHHHHHHHHHHHhhcCCCCC
Q 014841           41 HSLNNLVFY---VFNPALIGSNLAETI-TYQ--SLISLW-FMPVNILLSFLIGSALAWILIKITRTPPHL  103 (417)
Q Consensus        41 k~lS~lv~~---vflP~LiFs~l~~~i-t~~--~i~~~w-~ipv~~ll~~~ig~~lg~l~~~i~~~P~~~  103 (417)
                      +-++++-.+   ...+=|+|.++...+ +++  +..+.. -.-.+.++++.++..+|+++...+++....
T Consensus        33 ~~~g~lFi~lL~m~v~PLIf~sii~gi~~L~~~~~gkl~~~ti~~~l~tt~iA~~igl~~~~~~~pg~~~  102 (405)
T d2nwwa1          33 KPFGDLFVRLLKMLVMPIVFASLVVGAASISPARLGRVGVKIVVYYLLTSAFAVTLGIIMARLFNPGAGI  102 (405)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHTTTCSCTTTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCSCCCC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHhccchhcchHHHHHHHHHHHHHHHHHHHHHHHHHHhcccccc
Confidence            344444433   345667888887777 333  333443 455667788899999999999999987743


No 5  
>d1tm9a_ a.225.1.1 (A:) Hypothetical protein MG354 {Mycoplasma genitalium [TaxId: 2097]}
Probab=3.13  E-value=3.8e+02  Score=19.57  Aligned_cols=15  Identities=27%  Similarity=0.729  Sum_probs=11.1

Q ss_pred             HHHHHHHHHhCCCCC
Q 014841          342 IVIVKAAYRFGFIGS  356 (417)
Q Consensus       342 i~iv~~~~k~g~i~~  356 (417)
                      .-+.+.++|+|++.|
T Consensus        98 fci~yflyhf~fl~d  112 (137)
T d1tm9a_          98 FCVIYFLYHFGFLKD  112 (137)
T ss_dssp             HHHHHHHHHTTCSCC
T ss_pred             hhHHHHHHHhccccc
Confidence            345677899999885


No 6  
>d1tbaa_ a.15.1.1 (A:) TAF(II)230 TBP-binding fragment {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
Probab=3.04  E-value=1.7e+02  Score=19.70  Aligned_cols=15  Identities=7%  Similarity=0.160  Sum_probs=13.1

Q ss_pred             CCCChhHHhhhhhhh
Q 014841           33 DLLGHSVTHSLNNLV   47 (417)
Q Consensus        33 ~iL~~~~~k~lS~lv   47 (417)
                      .+|+++.+|+++.+.
T Consensus        36 s~lD~E~k~~L~~Ls   50 (67)
T d1tbaa_          36 TGFDAELRENIGSLS   50 (67)
T ss_dssp             SSCCTTTHHHHTTCT
T ss_pred             cccCHHHHHHHHHHh
Confidence            389999999999876


No 7  
>d1v54l_ f.23.6.1 (L:) Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) {Cow (Bos taurus) [TaxId: 9913]}
Probab=3.03  E-value=5.9e+02  Score=15.64  Aligned_cols=28  Identities=18%  Similarity=0.320  Sum_probs=20.1

Q ss_pred             hhhhhHHHHHHHHHHHHHHHHHHHHHHh
Q 014841           69 LISLWFMPVNILLSFLIGSALAWILIKI   96 (417)
Q Consensus        69 i~~~w~ipv~~ll~~~ig~~lg~l~~~i   96 (417)
                      +.+=|-+-.-..+++..|++.-++++|-
T Consensus        14 v~Nk~rLla~m~~~fGsgfa~PF~ivRh   41 (46)
T d1v54l_          14 VENKWRLLAMMTLFFGSGFAAPFFIVRH   41 (46)
T ss_dssp             CSSHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             chhHHHHHHHHHHHHhccccchHHHHHH
Confidence            3444556666778888999988888763


No 8  
>d1jb0m_ f.23.19.1 (M:) Subunit XII of photosystem I reaction centre, PsaM {Synechococcus elongatus [TaxId: 32046]}
Probab=2.41  E-value=2.8e+02  Score=15.61  Aligned_cols=12  Identities=17%  Similarity=0.420  Sum_probs=7.0

Q ss_pred             HHHHHHhcchhh
Q 014841          264 IIGFVIGTISPF  275 (417)
Q Consensus       264 ilg~iig~iP~L  275 (417)
                      .++++|+++|-+
T Consensus         9 ~valvial~pg~   20 (31)
T d1jb0m_           9 YVALVIALLPAV   20 (31)
T ss_dssp             HHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHH
Confidence            455666666644


No 9  
>d1otsa_ f.20.1.1 (A:) Clc chloride channel {Escherichia coli [TaxId: 562]}
Probab=2.41  E-value=5.4e+02  Score=22.79  Aligned_cols=22  Identities=27%  Similarity=0.366  Sum_probs=14.0

Q ss_pred             hcccChhHHHHHHHHHHhcchh
Q 014841          253 KMIFAPSTIAAIIGFVIGTISP  274 (417)
Q Consensus       253 ~~~~~Pp~ia~ilg~iig~iP~  274 (417)
                      +.-+.--.++.++|++.|++-.
T Consensus        14 ~~~l~~~~la~liGi~~gl~~~   35 (444)
T d1otsa_          14 KTPLAILFMAAVVGTLVGLAAV   35 (444)
T ss_dssp             CCCHHHHHHHHHHHHHHHHHHH
T ss_pred             ccHHHHHHHHHHHHHHHHHHHH
Confidence            4444455677788888886543


No 10 
>d1q90r_ f.23.12.1 (R:) ISP subunit from the cytochrome b6f complex, transmembrane anchor {Chlamydomonas reinhardtii [TaxId: 3055]}
Probab=2.26  E-value=3.3e+02  Score=16.38  Aligned_cols=28  Identities=7%  Similarity=-0.105  Sum_probs=17.2

Q ss_pred             hcccChhHHHHHHHHHHhcchhhhhccc
Q 014841          253 KMIFAPSTIAAIIGFVIGTISPFRKVIV  280 (417)
Q Consensus       253 ~~~~~Pp~ia~ilg~iig~iP~Lr~lff  280 (417)
                      |+++|=-+.|++-+-..|+.-|.-+.|+
T Consensus        10 R~~MNLll~G~~~~~~~g~l~py~~fFv   37 (39)
T d1q90r_          10 RNIMNLILAGGAGLPITTLALGYGAFFV   37 (39)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHS
T ss_pred             HHHHHHHHHhccchhhhhhccceeEEec
Confidence            3344444777777777777666655554


Done!