Query         014844
Match_columns 417
No_of_seqs    156 out of 330
Neff          3.0 
Searched_HMMs 46136
Date          Fri Mar 29 09:03:55 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/014844.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/014844hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF06203 CCT:  CCT motif;  Inte  99.6 1.2E-15 2.6E-20  113.6   2.0   38  380-417     1-38  (45)
  2 KOG1601 GATA-4/5/6 transcripti  97.0 0.00028 6.1E-09   61.7   1.3   41  377-417   290-330 (340)
  3 PF09425 CCT_2:  Divergent CCT   94.2   0.028 6.1E-07   38.8   1.6   24  379-403     3-26  (27)
  4 PF11302 DUF3104:  Protein of u  17.3      65  0.0014   27.1   1.0   26  247-272     4-37  (75)
  5 PF07597 DUF1560:  Protein of u  13.6      73  0.0016   24.7   0.4   16  395-410    10-25  (49)
  6 KOG2422 Uncharacterized conser  12.5   1E+02  0.0022   34.7   1.2   16  293-308    93-108 (665)
  7 PF13653 GDPD_2:  Glycerophosph  12.1      88  0.0019   22.0   0.4   14  194-207    14-27  (30)
  8 PF03286 Pox_Ag35:  Pox virus A  11.9 1.9E+02  0.0041   28.2   2.6    9  263-271    35-43  (200)
  9 PF07797 DUF1639:  Protein of u  11.1 1.3E+02  0.0028   23.8   1.0   12   51-62     16-27  (50)
 10 KOG3536 Adaptor protein CED-6,  11.0 1.6E+02  0.0034   30.8   1.9   37   34-70    249-290 (321)

No 1  
>PF06203 CCT:  CCT motif;  InterPro: IPR010402 The CCT (CONSTANS, CO-like, and TOC1) domain is a highly conserved basic module of ~43 amino acids, which is found near the C terminus of plant proteins often involved in light signal transduction. The CCT domain is found in association with other domains, such as the B-box zinc finger, the GATA-type zinc finger, the ZIM motif or the response regulatory domain. The CCT domain contains a putative nuclear localisation signal within the second half of the CCT motif and has been shown to be involved in nuclear localization and probably also has a role in protein-protein interaction [].; GO: 0005515 protein binding
Probab=99.55  E-value=1.2e-15  Score=113.64  Aligned_cols=38  Identities=58%  Similarity=0.915  Sum_probs=37.3

Q ss_pred             HHHHHHHHHHHhhccCCCCcccccccccccccCCCCCC
Q 014844          380 REASVLRYKEKRRTRLFSKKIRYQVRKVNADRRPRMKV  417 (417)
Q Consensus       380 Rea~v~RYkEKRk~R~F~KkIRY~~RK~~Ad~RPRvKG  417 (417)
                      |+++|+||+|||++|+|+|+|||+|||.+||.||||||
T Consensus         1 R~~~l~Ry~~Kr~~R~f~kkirY~~Rk~~A~~R~RvkG   38 (45)
T PF06203_consen    1 REEKLQRYREKRKRRNFEKKIRYESRKAVADKRPRVKG   38 (45)
T ss_pred             CHHHHHHHHHHHHhhcccccCCcchHHHHHhhCCccCC
Confidence            78999999999999999999999999999999999998


No 2  
>KOG1601 consensus GATA-4/5/6 transcription factors [Transcription]
Probab=96.99  E-value=0.00028  Score=61.74  Aligned_cols=41  Identities=51%  Similarity=0.741  Sum_probs=39.0

Q ss_pred             chhHHHHHHHHHHHhhccCCCCcccccccccccccCCCCCC
Q 014844          377 GGLREASVLRYKEKRRTRLFSKKIRYQVRKVNADRRPRMKV  417 (417)
Q Consensus       377 ~~~Rea~v~RYkEKRk~R~F~KkIRY~~RK~~Ad~RPRvKG  417 (417)
                      ...|++.+.||+++++.|.|+++|+|..|+.+|+.|||++|
T Consensus       290 ~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  330 (340)
T KOG1601|consen  290 SHQRVAEVRRYRESRDGRYFDKGIRYASRKSNAESRPRLKG  330 (340)
T ss_pred             cchHHHHHhhccCccCCcccccccccccccccchhcccccc
Confidence            46899999999999999999999999999999999999986


No 3  
>PF09425 CCT_2:  Divergent CCT motif;  InterPro: IPR018467 The short CCT (CO, COL, TOC1) motif is found in a number of plant proteins, including Constans (CO), Constans-like (COL) and TOC1. The CCT motif is about 45 amino acids long and contains a putative nuclear localisation signal within the second half of the CCT motif []. The CCT motif is found in the Arabidopsis circadian rhythm protein TOC1, an autoregulatory response regulator homologue the controls the photoperiodic flowering through its clock function []. ; GO: 0005515 protein binding; PDB: 3OGK_V 3OGL_S 3OGM_W.
Probab=94.21  E-value=0.028  Score=38.77  Aligned_cols=24  Identities=50%  Similarity=0.693  Sum_probs=9.9

Q ss_pred             hHHHHHHHHHHHhhccCCCCccccc
Q 014844          379 LREASVLRYKEKRRTRLFSKKIRYQ  403 (417)
Q Consensus       379 ~Rea~v~RYkEKRk~R~F~KkIRY~  403 (417)
                      .|.++|+||.||||.|++. +.-|.
T Consensus         3 aRK~SLqRFLeKRK~R~~~-~~PY~   26 (27)
T PF09425_consen    3 ARKASLQRFLEKRKDRLAA-KSPYQ   26 (27)
T ss_dssp             ---HHHHHHHHHH------------
T ss_pred             hHHHHHHHHHHHHHHhhcc-CCCCC
Confidence            5999999999999999998 66664


No 4  
>PF11302 DUF3104:  Protein of unknown function (DUF3104);  InterPro: IPR021453  This family of proteins with unknown function appears to be restricted to Cyanobacteria. 
Probab=17.28  E-value=65  Score=27.14  Aligned_cols=26  Identities=15%  Similarity=0.516  Sum_probs=15.6

Q ss_pred             ccccccc-------ccccccCCCCcccccc-ccc
Q 014844          247 FGMRSGM-------KALRQVDEGNWWNFPI-DVL  272 (417)
Q Consensus       247 lG~r~~~-------~ALR~~dd~~wW~~p~-dv~  272 (417)
                      |+++.|+       +..-+..+.+|||-=+ .+.
T Consensus         4 L~Vk~Gd~ViV~~~~~~~~~~~~dWWmg~Vi~~~   37 (75)
T PF11302_consen    4 LSVKPGDTVIVQDEQEVGQKQDKDWWMGQVIHCE   37 (75)
T ss_pred             cccCCCCEEEEecCccccccCCCCcEEEEEEEEe
Confidence            4556663       2333455789999766 443


No 5  
>PF07597 DUF1560:  Protein of unknown function (DUF1560);  InterPro: IPR011454 This is a small family of short hypothetical proteins in Rhodopirellula baltica.
Probab=13.63  E-value=73  Score=24.67  Aligned_cols=16  Identities=31%  Similarity=0.665  Sum_probs=13.4

Q ss_pred             CCCCcccccccccccc
Q 014844          395 LFSKKIRYQVRKVNAD  410 (417)
Q Consensus       395 ~F~KkIRY~~RK~~Ad  410 (417)
                      .|.|++|++||+..|.
T Consensus        10 ~~~~~~rwecrrfeak   25 (49)
T PF07597_consen   10 SFAKRSRWECRRFEAK   25 (49)
T ss_pred             ccCCcchhhhhhhhhc
Confidence            5889999999987663


No 6  
>KOG2422 consensus Uncharacterized conserved protein [Function unknown]
Probab=12.55  E-value=1e+02  Score=34.68  Aligned_cols=16  Identities=25%  Similarity=0.381  Sum_probs=6.9

Q ss_pred             hhhhhhcccCCccccc
Q 014844          293 SEKRKKKVGKEKPVAE  308 (417)
Q Consensus       293 ~kKKkkKkk~~~~~~e  308 (417)
                      +||||||||+.+.+++
T Consensus        93 KKK~krkkKk~~~~~d  108 (665)
T KOG2422|consen   93 KKKKKRKKKKSTAEVD  108 (665)
T ss_pred             chhhhhccccccCccc
Confidence            3444444444444444


No 7  
>PF13653 GDPD_2:  Glycerophosphoryl diester phosphodiesterase family; PDB: 3RLG_A 2F9R_B 1XX1_A 3RLH_A.
Probab=12.08  E-value=88  Score=21.96  Aligned_cols=14  Identities=36%  Similarity=0.634  Sum_probs=9.8

Q ss_pred             chHHHhhhhhhccc
Q 014844          194 DEEFEEGIDSIMGN  207 (417)
Q Consensus       194 dEe~eeGIDsIMG~  207 (417)
                      -+.++.|+|+||=.
T Consensus        14 ~~~l~~GVDgI~Td   27 (30)
T PF13653_consen   14 RELLDLGVDGIMTD   27 (30)
T ss_dssp             HHHHHHT-SEEEES
T ss_pred             HHHHHcCCCEeeCC
Confidence            46678899999843


No 8  
>PF03286 Pox_Ag35:  Pox virus Ag35 surface protein;  InterPro: IPR004966 The Pox virus Ag35 surface protein is an evelope protein known as protein H5.; GO: 0019031 viral envelope
Probab=11.86  E-value=1.9e+02  Score=28.20  Aligned_cols=9  Identities=44%  Similarity=0.383  Sum_probs=6.1

Q ss_pred             Ccccccccc
Q 014844          263 NWWNFPIDV  271 (417)
Q Consensus       263 ~wW~~p~dv  271 (417)
                      +==-||.|+
T Consensus        35 ~DdiFP~DI   43 (200)
T PF03286_consen   35 NDDIFPEDI   43 (200)
T ss_pred             ccccCcccc
Confidence            444688877


No 9  
>PF07797 DUF1639:  Protein of unknown function (DUF1639);  InterPro: IPR012438 This approximately 50-residue region is found in a number of sequences derived from hypothetical plant proteins. This region features a highly basic 5 amino-acid stretch towards its centre. 
Probab=11.13  E-value=1.3e+02  Score=23.81  Aligned_cols=12  Identities=42%  Similarity=0.971  Sum_probs=10.6

Q ss_pred             ecCCCCCCCCCC
Q 014844           51 TRKARTPRKRPN   62 (417)
Q Consensus        51 tkrpRTpRKRPN   62 (417)
                      +|-||.|+|||-
T Consensus        16 ~kpprRPkKRpk   27 (50)
T PF07797_consen   16 SKPPRRPKKRPK   27 (50)
T ss_pred             CCCCCCCCcccH
Confidence            678999999997


No 10 
>KOG3536 consensus Adaptor protein CED-6, contains PTB domain [General function prediction only]
Probab=10.98  E-value=1.6e+02  Score=30.75  Aligned_cols=37  Identities=27%  Similarity=0.284  Sum_probs=24.9

Q ss_pred             CCCCcccccCCCC-----cceeecCCCCCCCCCChhHHHHHH
Q 014844           34 SPLSTLSEASNSP-----LAISTRKARTPRKRPNQTYNEAAA   70 (417)
Q Consensus        34 SpSSTlSEaSNsp-----~sistkrpRTpRKRPNQTYNEAAa   70 (417)
                      +-||+-.+-+++|     .++-..|.-.-|++|||..||-.+
T Consensus       249 ~~ss~~~~~~~~pp~vp~~~e~~srl~~~~~~P~q~~~~g~~  290 (321)
T KOG3536|consen  249 SVSSVVWELSDSPPSVPKDSEAFSRLAASRTNPPQALDEGLT  290 (321)
T ss_pred             hcccccccccCCCCCCCCCcchhhhhhccCCCCCcccccccc
Confidence            4566677777775     333355666778889998888543


Done!