BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 014851
(417 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1DP4|A Chain A, Dimerized Hormone Binding Domain Of The Atrial Natriuretic
Peptide Receptor
pdb|1DP4|C Chain C, Dimerized Hormone Binding Domain Of The Atrial Natriuretic
Peptide Receptor
pdb|1T34|A Chain A, Rotation Mechanism For Transmembrane Signaling By The
Atrial Natriuretic Peptide Receptor
pdb|1T34|B Chain B, Rotation Mechanism For Transmembrane Signaling By The
Atrial Natriuretic Peptide Receptor
pdb|3A3K|A Chain A, Reversibly Bound Chloride In The Atrial Natriuretic
Peptide Receptor Hormone-Binding Domain
pdb|3A3K|B Chain B, Reversibly Bound Chloride In The Atrial Natriuretic
Peptide Receptor Hormone-Binding Domain
Length = 435
Score = 29.6 bits (65), Expect = 3.7, Method: Compositional matrix adjust.
Identities = 16/32 (50%), Positives = 20/32 (62%), Gaps = 1/32 (3%)
Query: 195 PSPGAFRLGLNPNG-SRELMVWRRGEVYWRSG 225
P GAFR+ LN NG S+ELM ++YW G
Sbjct: 383 PETGAFRVVLNYNGTSQELMAVSEHKLYWPLG 414
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.318 0.135 0.434
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 13,666,894
Number of Sequences: 62578
Number of extensions: 626789
Number of successful extensions: 1129
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 1126
Number of HSP's gapped (non-prelim): 6
length of query: 417
length of database: 14,973,337
effective HSP length: 101
effective length of query: 316
effective length of database: 8,652,959
effective search space: 2734335044
effective search space used: 2734335044
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)